KEGG   Vibrio parahaemolyticus BB22OP: VPBB_A1006Help
Entry
VPBB_A1006        CDS       T02409                                 

Definition
Cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Brite
Enzymes [BR:vpb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     VPBB_A1006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1130271..1131233)
Genome map
AA seq 320 aa AA seqDB search
MRLSTAIKWGAAVLFVCTASSVSVAKAEVELVLPIEGDPVVDVTLARIGWHLFRDPNLSS
NGKVSCESCHNLQTNGAQNTAVAAGVKGAGTRNAITVFNASLNYRLLWDGSSNTLVSQMD
GPIHDPLEMDSNWPKIESYVQNNEQYQALFKRAGNLPISIDNIKASIVEFVKGLETPGAP
FDAYLLGYTHVLSEKAKRGWKTFQKAGCVQCHQGKNVGGAMIQRFAYFEHKPVQKDTGRH
LLTTEGDEGYYFRVASLRNVALTGPYFHNGQVTTLAEAIQIMAQTQLGITMSDSNIEDIE
AFLTSLSAPRPVILEVLENE
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgagtacagctatcaaatggggtgccgccgtgctattcgtttgtaccgcatca
tccgtcagtgttgcaaaagcagaagtcgaacttgttttgcctatcgagggcgatccggtc
gtcgacgttacgttagcgcggattggttggcatttatttagagacccaaacctgtcatcg
aatggtaaagtcagttgtgaaagttgccacaatctacaaacgaatggcgcgcaaaacaca
gccgtagcagcaggtgtaaaaggggcaggaacacgaaacgcgatcacggtttttaatgcg
tcactgaattaccgactgttatgggacggctcgtcgaatacgttagtctctcaaatggat
ggcccaattcacgacccgctagaaatggattccaactggccgaagattgaaagctacgtt
caaaacaacgagcagtatcaagcgctgtttaaacgcgctggaaacctgccaatttctatc
gacaacatcaaagcgtccattgttgagtttgtgaaagggcttgaaactcccggcgcgccg
tttgatgcctacttattgggttacacgcatgttttgagtgagaaagcgaaacgcggttgg
aaaaccttccagaaagctgggtgcgtacaatgtcatcaagggaaaaatgttggcggcgcg
atgattcaacgcttcgcttactttgagcataaacccgtgcagaaagacacaggtcgccat
ttactcacaacggaaggggatgaggggtattatttccgtgttgccagtttaagaaacgtc
gcattaacggggccgtattttcataacgggcaagtgaccacccttgctgaggccattcaa
atcatggcacaaacgcagcttggtattacgatgagtgatagcaacatcgaagacatcgaa
gcgttcttgacgtcactcagcgccccaaggccagtaatattagaggtgctggaaaatgaa
taa

DBGET integrated database retrieval system