KEGG   Vibrio parahaemolyticus BB22OP: VPBB_A1044Help
Entry
VPBB_A1044        CDS       T02409                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    VPBB_A1044
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VPBB_A1044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1176905..1177567
Genome map
AA seq 220 aa AA seqDB search
MRTKQPSERVLPLAFTLLALLSAPVLASNDELIAAGEKQAMVCKACHQFEPNGVTLVGPP
LWGLAERNIASFEGFNYSDGIRQHQGKWDAEKLDAFLSAPNDFAPETNMVFPGVTDPGAR
AAIIAWLATKNPTPPNWNMTSSGLEVKSTGDGILTPGENMELVAAVCSACHSLHMVTQQG
LSRQRWDETLDWMIEEQGMEDLSGDDREAILEYLSTYYGG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
gtgagaacaaaacaaccatcagagcgggtactcccgctcgctttcacccttttggctttg
ttgagcgcccctgtccttgcgagtaacgacgagttgattgcagcaggcgagaagcaagcc
atggtttgtaaagcctgccatcaatttgagccgaatggcgtaacgctggttggcccgccc
ttatgggggctagcggagcgcaatatcgccagttttgagggcttcaattacagcgacgga
attagacaacatcaaggaaagtgggacgctgaaaagttggacgcatttttatccgctccg
aatgacttcgcgccagaaaccaacatggtcttccctggcgtaacagatcccggtgcgcgc
gcggctatcattgcatggcttgcaacgaaaaacccgacaccacccaattggaatatgacg
tcatcaggattggaggttaaatcgacaggtgatgggatattaacgccgggagagaatatg
gagctcgtcgcagcagtctgctcagcctgtcattcgttacacatggtcacacaacaagga
ctaagccgccaaagatgggatgaaaccctcgactggatgattgaagagcaaggtatggaa
gatttatcaggcgacgaccgagaagccattctagaatacctttctacctattatggaggg
taa

DBGET integrated database retrieval system