KEGG   Vibrio parahaemolyticus BB22OP: VPBB_A1483Help
Entry
VPBB_A1483        CDS       T02409                                 

Definition
4-alpha-glucanotransferase (amylomaltase)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VPBB_A1483
Enzymes [BR:vpb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     VPBB_A1483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1659296..1661476)
Genome map
AA seq 726 aa AA seqDB search
MKEQTALKKVAEMARLADSYVSAWGDEAKVSDETLRRLLTSLGYDTSSDEKLLASAEKKH
KKDVLAPVLVLRDGEPVEVELNLGTSARESEFSWRLETEQGEVLEGYLQSQIVRDERAEG
GPLVFALPKNLAWGYHKLIISRKRRKTPYEMSLIITPKACFKQEDLNQHKKLWGPSIQLY
TLRTQHNWGIGDFGDLKQLVSDIASRGGDFIGLNPIHSLFPANPEGASPYSPSSRRWLNI
MYIDVSSVPEFALSAEAQQRVGSAEFQQRLQKARDSHWVNYTEVSQLKMSVLPLLFSEFK
ARHLDKNTDRARAFLDFVEKGGESLLHQAAFDALHADLHAEDSGVWGWPVFPEKYRTFDA
AGTQKYIKDNQDRVHLYMYLQWIADDQIKEAQALAEEKGMAVGLYRDLAVGVADSGSETW
ADEGSLVLDASIGAPPDILGPLGQNWGLPPLNPQVLEATGYDAYIKLLRANMKHCGALRI
DHVLGLLRLWWIPKGEKATEGAYLYYPVEDMLAILALESHRHQCSVIGEDLGTVPDEIVD
ILRDAGVHSYKVFFFETSKEDGGFISPKHYAEQSMAALCTHDMPTLRGFWHCDDLKMGRE
IGLYPDEKQLEGLFADRLKCKQGILDSVRWHGYLPEGIGHDAQFVPMDSYLSEALQLHVA
AGDSALLSVQLEDWLEMDQPVNIPGTVDEYPNWRRKLSMNLDEIFSREDVNRISKRLTEV
RAQASK
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacaaacagcattaaagaaagtcgcggaaatggcgagattggctgatagctat
gtcagcgcgtggggagacgaggcaaaagtttctgacgagactctacgccgcttgctcact
tcactaggctacgatactagcagcgatgaaaaactattggcttctgctgaaaagaaacat
aagaaagacgtactagcccctgttcttgttttacgcgacggcgaaccagtcgaagtggaa
ctaaacctaggtacgagtgctcgtgagagtgaattcagctggcgtttagaaacagaacaa
ggagaggtacttgaaggctatcttcagtctcaaattgttcgtgatgagcgtgctgagggt
ggccctctagtgtttgcattgccaaagaacttggcatggggttaccacaaactgatcatc
agtcgtaagcgtcgtaaaacgccttacgagatgtcattgatcatcacaccgaaagcgtgt
ttcaaacaagaagacctaaaccaacacaaaaaactgtggggtccaagcattcagctttac
acactgcgtactcagcataactggggcatcggtgattttggtgacctaaaacagttggtg
agtgacattgcctctcgtggtggtgacttcattggcttgaacccaattcactcacttttc
ccagcaaacccagaaggtgcgagcccatacagcccgtcttctcgtcgctggctgaacatc
atgtacatcgacgtaagctctgtacctgagtttgcgctaagtgcagaagcacaacagcga
gtgggcagcgcagagttccaacaacgtctacaaaaagcgcgtgactcacattgggtgaac
tacaccgaagtttctcaactaaaaatgagcgtattgccgctgctgtttagtgagttcaag
gctcgtcatctcgataaaaacacggaccgcgctcgcgcattcttagatttcgtagagaag
ggcggcgaaagtttattgcaccaagcggcatttgatgcgcttcacgcagatttgcacgct
gaagattctggcgtttggggttggcctgtattccctgagaaataccgcacattcgacgcg
gctggcactcagaaatacatcaaagacaaccaagatcgcgttcacttgtacatgtaccta
caatggatcgcagacgatcaaatcaaagaagcgcaagccctagctgaagaaaaaggcatg
gctgtgggtctgtaccgcgaccttgctgtaggtgttgctgattctggcagtgagacatgg
gcggatgaaggcagcctagtgctggatgcaagcatcggtgcgccaccagatattcttggt
cctctaggtcaaaactggggtctgccaccgcttaaccctcaagtgttggaagcgacaggc
tacgatgcgtacatcaagttgctacgtgccaacatgaaacattgtggtgcactgcgtatc
gaccacgtacttggcctattgcgtctatggtggattccaaaaggcgaaaaagcgacagaa
ggcgcgtacttgtactacccagtagaagacatgctcgcaatcctagcgcttgagtcgcac
cgtcatcagtgctctgtgattggtgaagacttaggtactgtgccagatgaaatcgttgat
atcctacgtgatgcgggcgtgcattcgtacaaagtcttcttcttcgaaacctcaaaagag
gacggcggctttatttctccgaagcattacgcagagcagtctatggcggcattgtgtacg
cacgacatgccaaccctacgcggcttctggcactgtgatgatttgaaaatgggtcgtgag
attggtctgtacccagatgaaaaacagttggaaggcttattcgctgaccgtttgaagtgc
aaacaaggcatcctagacagcgttcgttggcacggttacttgccagaaggcattggccat
gatgcgcagttcgtaccaatggattcatacctaagcgaagcgcttcaattgcacgttgct
gcgggtgattctgcactgcttagcgttcagcttgaagactggttagaaatggatcaaccg
gtcaacattcctggcacggttgatgagtatccaaactggcgtcgtaagctgtcgatgaac
ctagatgaaatcttcagtcgtgaagacgtgaatcgcatttctaaacgccttacagaagtt
cgcgcacaggcgagcaaataa

DBGET integrated database retrieval system