KEGG   Variovorax paradoxus B4: VAPA_1c00350Help
Entry
VAPA_1c00350      CDS       T02835                                 

Definition
alpha/beta hydrolase family protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
vpd  Variovorax paradoxus B4
Brite
Enzymes [BR:vpd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     VAPA_1c00350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(36522..37400)
Genome map
AA seq 292 aa AA seqDB search
MSARDPSDLLSVVHPAVRRTAVVLLHGLCSTPDELLTVQSALRASGYSVHPMRVDGYSFD
AAAPVQQALPYECWIDAIEAQVKLLRTQHDRVMLVGISAGSSLALGAAIRCGSGVDALVL
MSTTLRFDGWAVPRTQVLLPLAFYTPLGRFWQYRERPPYGVKNERVRAWIERELRHRKVS
SAGSAVIGVGHLREHDRLIRHVRRNLHRVQCDSVLALHAREDEVASVANLGLLARGLRCR
TFRSVVLANSYHMITIDNDRHQVVRETSAFADAVAHGTPDAIDALSARSLAA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcccgcgatccctccgatctcctgagcgtggtgcaccccgcggtgcggcgcacg
gccgtcgtgctgctgcatggtttatgcagcacacctgacgagctcctgaccgtgcagtcg
gcattgcgcgccagcgggtactcggtgcatccgatgcgtgtcgacggctactccttcgat
gccgccgcaccggtgcagcaggccctgccgtacgagtgctggatcgacgccatcgaggcg
caggtcaagctgctgcgcacgcagcatgaccgtgtgatgctggtgggcatctcggccgga
tcgtcgctggcgctcggcgcagccatccgctgcggcagcggcgtcgatgcgctggtgctg
atgtcgaccacgctgcgcttcgacggctgggccgtgccgcgaacgcaggtgctgctgccg
ctggccttctacacgccgctcgggaggttctggcaataccgcgaacgcccgccctacggc
gtgaagaacgaacgcgtgcgcgcctggatcgagcgcgagctgcgccaccgcaaggtgtcg
agcgccggcagcgcagtgatcggcgtgggccacctgcgcgagcacgaccggctgatccgc
catgtgaggcgcaatctccatcgcgtgcaatgcgacagcgtgctcgcgctgcatgcacgc
gaggacgaggtggccagtgtggccaatctcggcctccttgcgcgcggccttcgctgcagg
acgttccgcagcgtggtgctggccaacagctaccacatgatcacgatcgacaacgaccgc
caccaggtggtgcgcgaaacgtccgccttcgccgatgccgtggcccatggcacgcccgac
gccatcgacgccttgtccgcgcgctcccttgccgcctga

DBGET integrated database retrieval system