KEGG   Variovorax paradoxus B4: VAPA_1c04950Help
Entry
VAPA_1c04950      CDS       T02835                                 

Gene name
glgB1
Definition
1,4-alpha-glucan-branching enzyme Glgb (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
vpd  Variovorax paradoxus B4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:vpd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VAPA_1c04950 (glgB1)
Enzymes [BR:vpd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     VAPA_1c04950 (glgB1)
Exosome [BR:vpd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VAPA_1c04950 (glgB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(534876..537047)
Genome map
AA seq 723 aa AA seqDB search
MPPLLLPEREVHALMRAEHDDPFAVLGPHETRDGLLVRALLPGAQSVAVMHTRTGWPLAM
LSRQEGSDLFAGLVPAAEALLGYSFQVDWGTHTSRLEDPYRFAFVLGATDVWLLSEGTHL
RPWERLGAHLREMDGVKGVAFAVWAPNARRVSVVGDFNNWDGRRHTMRLRRECGVWEIFA
PQVAVGDSYEFEILSAQGEVLRKADPFAFSSRLRPETACVVAPLPAPMAMPPERAAANGR
HAPMSIYEVHLGSWRRKNGHEWLDYRELADTLVPYARDMGFTHIELLPVSEHPFDGSWGY
QPIGLYAPTSRFGTPGDFRHLVEAAHAAGLGVILDWVPAHFPTDAHGLGRFDGTALYEYA
DPREGFHNDWKTLIFNYGRTEVRNYLVGNALYWLERYGVDGLRVDAVASMLYRDYSRKPG
EWVPNAYGGRENLEAIAFLRRMNQVVGVERPGAVTLAEESTSFPGVTRPPEDGGLGFHYK
WNMGWMNDTLAYAGTDPVHRKHHHQQITFGLMYAHSENFVLPLSHDEVVHGKGSMLGRMP
GDEWQKFAGLRNLYGYLWAYPGKKLLFMGGEFAQAAEWNADRSLDWHLLEHASHQGVRRL
VRDLNNVYRHFPALYELDTERAGFEWLVHDDWEQSVFAFVRRARDGSFVVAVCNFTPLPR
HGYRLGVPAAGAYREAINTDGAVYGGSGVGNGVVDSAPVPWHGRADSISISVPPLATVMW
VLA
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccctgctgctgcctgaacgcgaagtccatgcgctgatgcgcgccgagcacgac
gatccgttcgcggtgctcggcccccacgaaacacgcgacggcctgctggtgcgcgcgctg
ctgccgggggcgcagagcgtggccgtgatgcacacgcgcacgggctggccgctggccatg
ctgtcgcggcaggaaggctccgacctcttcgcgggcctggtgcccgcggcggaggcgctc
ctgggctattcgttccaggtcgactggggcacgcacacctcgcggctcgaggacccgtac
cgctttgccttcgtgctgggcgccaccgatgtgtggctgctgtccgagggcacgcacctg
cggccctgggagcggctgggcgcgcacctgcgcgagatggatggcgtgaagggcgtggcc
ttcgcggtctgggcgcccaatgcgcggcgcgtctcggtggtcggcgacttcaacaactgg
gacggccggcgccacacgatgcggctgcgccgcgagtgcggcgtgtgggaaatcttcgcg
ccgcaggtggccgtgggcgacagctacgagttcgaaatcctctcggcccagggcgaggtg
ctgcgcaaggccgaccccttcgccttttcctcgcgcctgcggcccgagaccgcctgcgtg
gtggcgccgctgcccgcaccgatggccatgccgcccgagcgtgccgccgccaatggccgc
catgcgccgatgagcatctacgaggtgcacctgggctcctggcgccgcaagaacggccat
gaatggctggactaccgcgagctggccgacacgctggtgccgtacgcgcgcgacatgggc
ttcacgcacatcgagctgctgccggtcagcgagcacccgttcgacggctcgtggggctac
cagccgatcggcctttatgcgcccacctcgcgcttcggcacgcccggcgacttccgccat
ctcgtcgaagccgcgcatgccgcggggctgggcgtgatcctcgactgggtgcccgcgcac
tttcccaccgacgcgcacggcctcggccgtttcgacggcaccgcgctctacgaatacgcc
gacccgcgcgaaggcttccacaacgactggaagacgctcatcttcaactacggccgtacg
gaggtgcgcaactacctggtcggcaatgcgctgtactggctcgagcgctacggcgtggac
ggcctgcgcgtcgatgcggtggcctccatgctctaccgcgactacagccgcaagcccggc
gaatgggtgcccaacgcctatggcgggcgcgagaacctcgaagccatcgctttcctgcgg
cgcatgaaccaggtggtgggcgtcgagcgcccgggcgccgtcacgctggccgaggagtcg
acgagttttccgggcgtgacgcggccgcccgaggatggcggcctcggcttccactacaaa
tggaacatgggctggatgaacgacaccctggcctatgcgggcaccgacccggtccaccgc
aagcaccaccaccagcagatcaccttcggcctgatgtatgcgcacagcgagaacttcgtg
ctgccgctctcgcacgacgaggtggtgcacggcaagggctcgatgctcgggcgcatgccc
ggcgacgagtggcagaagttcgcggggctgcgcaatctttatggctacctctgggcctat
ccgggcaagaagctgctgttcatgggcggcgaattcgcccaggcagcggaatggaacgcc
gaccgcagcctcgactggcacctgctggagcacgcgtcgcaccagggcgtccggcggctg
gtgcgcgacctgaacaacgtgtaccggcacttccccgcgctgtacgaactcgataccgaa
agggccggcttcgagtggctggtgcatgacgactgggagcagtcggtgttcgccttcgtg
cgccgggcccgcgacggctctttcgtggtggcggtgtgcaacttcacgccgctgccgcgc
cacggctatcgcctcggggtgcctgcggcgggcgcgtaccgcgaggccatcaacaccgac
ggcgccgtgtacggcggcagcggtgtcggcaatggcgtggtcgacagcgcaccggttccc
tggcacggcagggccgactccatttccatcagcgtgccgcccctggccaccgtgatgtgg
gtgctggcttga

DBGET integrated database retrieval system