KEGG   Variovorax paradoxus B4: VAPA_1c19150Help
Entry
VAPA_1c19150      CDS       T02835                                 

Gene name
alaA
Definition
(GenBank) glutamat-pyruvat aminotransferase AlaA
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vpd  Variovorax paradoxus B4
Pathway
vpd00220  Arginine biosynthesis
vpd00250  Alanine, aspartate and glutamate metabolism
vpd00290  Valine, leucine and isoleucine biosynthesis
vpd01100  Metabolic pathways
vpd01110  Biosynthesis of secondary metabolites
vpd01130  Biosynthesis of antibiotics
vpd01210  2-Oxocarboxylic acid metabolism
vpd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vpd00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VAPA_1c19150 (alaA)
   00290 Valine, leucine and isoleucine biosynthesis
    VAPA_1c19150 (alaA)
   00220 Arginine biosynthesis
    VAPA_1c19150 (alaA)
Enzymes [BR:vpd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     VAPA_1c19150 (alaA)
    2.6.1.66  valine---pyruvate transaminase
     VAPA_1c19150 (alaA)
Amino acid related enzymes [BR:vpd01007]
 Aminotransferase (transaminase)
  Class I
   VAPA_1c19150 (alaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGU49021
UniProt: T1X964
Position
1:2041110..2042339
Genome map
AA seq 409 aa AA seqDB search
MKQFKKSAKLANVLYDIRGPIMDAAKQMEEEGQKIIRLNIGNLAVFGFDAPEEVQQDMIR
NLPASAGYSDSKGIFAARKAVMHETQKQGVAGVTLEDIYLGNGASELIAMATNALLNDGD
EMLLPAPDYPLWTAASSLSGGKPVHYVCDEANGWMPDLDDIRAKITPRTKGIVVINPNNP
TGALYSDELLKSIVAIAREHHLVIFADEVYDKVLYDGVRHTAIASLSTDVLTLTFNSLSK
SYRSCGYRAGWMVVSGDKARAQDYIEGLNMLSNMRLCANVPGQWAIQTALGGYQSINDLV
GDGGRLRRQRDLAYELITAIPGVSCVKPSAALYMFPKLDPKVYPIEDDRQFFLELLRETK
VMLVQGTGFNWATPDHFRIVFLPHEDDLREAINRIAKFLELYRLRSKTD
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcagttcaagaaatcggccaagctggccaacgtgctctacgacatccgcggcccc
atcatggacgccgcgaagcagatggaagaagagggccagaagatcatcaggctcaatatc
ggcaacctggccgtgttcggcttcgatgcgccggaggaagtccagcaggacatgatccgc
aacctgccggcgtcggcgggctattcggacagcaagggcatcttcgcggcccgcaaggcc
gtgatgcacgagacccagaagcagggcgttgcaggggtcacgctcgaggacatctacctg
ggcaacggcgcgagcgaactgatcgccatggccaccaacgcgttgctgaacgacggcgac
gaaatgctgctcccggcacccgactatcccctgtggacggccgcctcgagcctgtccggg
ggcaagccggtgcactacgtctgcgacgaagccaacggctggatgcccgacctggacgac
atccgcgccaagatcacgccccgcaccaagggcatcgtggtcatcaatccgaacaatccg
accggtgcgctttattccgacgaactgctcaagagcatcgtcgccattgcgcgcgagcac
cacctggtgatcttcgccgacgaggtgtacgacaaggtgctgtacgacggcgtcaggcac
accgcgatcgcgagcctttcgaccgacgtgctcacgctgaccttcaattcgctgtccaag
agctaccgctcgtgcggctaccgcgcgggctggatggtggtttcgggcgacaaggcgcgg
gcgcaggactacatcgagggcctgaacatgctctcgaacatgcgcctgtgcgccaacgtg
cccggacagtgggccatccagaccgcacttggcggctaccagagcatcaacgacctggtc
ggcgacggcggccgcctgcggcgccagcgcgacctggcctacgagctcatcacggccatt
ccgggtgtgagctgcgtcaagccgagcgccgcgctctacatgtttcccaagctcgatccc
aaggtctaccccatcgaggacgaccggcagttctttctcgagctgctgagggaaaccaag
gtgatgctggtgcagggcacgggcttcaactgggcgacgccggaccacttccgcatcgtg
ttcctgccccacgaggacgacttgcgcgaagcgatcaaccgcatcgccaagttcctggag
ctgtaccgcctgcgcagcaagacggattga

DBGET integrated database retrieval system