KEGG   Variovorax paradoxus B4: VAPA_1c21440Help
Entry
VAPA_1c21440      CDS       T02835                                 

Gene name
phbA1
Definition
(GenBank) acetyl-CoA acetyltransferase PhbA
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vpd  Variovorax paradoxus B4
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:vpd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VAPA_1c21440 (phbA1)
   00630 Glyoxylate and dicarboxylate metabolism
    VAPA_1c21440 (phbA1)
   00640 Propanoate metabolism
    VAPA_1c21440 (phbA1)
   00650 Butanoate metabolism
    VAPA_1c21440 (phbA1)
  Lipid metabolism
   00071 Fatty acid degradation
    VAPA_1c21440 (phbA1)
   00072 Synthesis and degradation of ketone bodies
    VAPA_1c21440 (phbA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VAPA_1c21440 (phbA1)
   00310 Lysine degradation
    VAPA_1c21440 (phbA1)
   00380 Tryptophan metabolism
    VAPA_1c21440 (phbA1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VAPA_1c21440 (phbA1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VAPA_1c21440 (phbA1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    VAPA_1c21440 (phbA1)
Enzymes [BR:vpd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VAPA_1c21440 (phbA1)
Exosome [BR:vpd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VAPA_1c21440 (phbA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:2269052..2270230
Genome map
AA seq 392 aa AA seqDB search
MEDIVIVSAARTAVGKFGGSLAGIPATELGALVIKEVIARANLTAEQVGEAIMGQVLAAG
AGQNPARQAWLKSGGTKETPALTINAVCGSGLKAVMLAAQAVATGDSEIVIAGGQENMSM
APHVLPNSRNGQRMGDWKLVDTMIVDGLWDVYNQYHMGITAENVAKKFGIDRAAQDELAL
GSQTKAAAAQDAGKFKDEIVGVSIPQKKGDPIVFNQDEFINRKTSADVLAGLRPAFDKAG
GVTAGNASGLNDGAAAVMVMTAKKAAALGLKPLGRIASYATAGLDPAIMGMGPVPASTKA
LQRAGWKAADLDLLEINEAFAAQACAVNKEMGWDVNKVNVNGGAIAIGHPIGASGCRILV
TLLHEMQRQNAKKGIASLCIGGGMGVALTIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaagacatcgtcatcgtttcggctgcacgcacggcggtcggcaagttcggcggctcg
ctcgccggtatccctgccaccgaactgggcgccctcgtgatcaaggaagtgattgcgcgc
gcgaatctcacggccgagcaggtcggcgaggcgatcatgggccaggtgctggcggcaggt
gccggccagaaccccgcgcgccaggcgtggctcaagagcggcggcaccaaggaaacgccg
gcactcaccatcaacgccgtctgcggctcgggcctgaaggccgtgatgctcgcggcacag
gccgtggccacgggcgacagcgagatcgtcattgccggcgggcaggagaacatgagcatg
gcgccgcacgtgctgcccaactcgcgcaacggccagcgcatgggcgactggaagctggtc
gacaccatgatcgtcgacggcctgtgggacgtctacaaccagtaccacatgggcatcacg
gccgagaacgtggccaagaagttcggcatcgaccgcgccgcgcaggacgagctcgcgctc
ggcagccagaccaaggcggcggccgcacaggatgccggcaagttcaaggacgagatcgtc
ggcgtgagcattccgcagaagaagggcgaccccatcgtcttcaaccaggacgagttcatc
aaccgcaagaccagcgccgacgtgctggccggcctgcgccccgccttcgacaaggcgggc
ggcgtgaccgcgggcaatgcctcgggcctgaacgatggcgctgccgccgtgatggtgatg
acggccaagaaggccgccgcgctcggcctcaagccgctggggcgcatcgccagctacgcc
actgccggcctcgacccggccatcatgggcatgggcccggtgcccgcgtcgaccaaggcg
ctgcagcgcgccggctggaaggctgccgacctcgacctgctcgagatcaacgaagccttt
gcggcgcaggcctgcgccgtgaacaaggaaatgggctgggacgtgaacaaggtcaacgtg
aacggcggcgccattgccatcggccacccgatcggcgcgtcgggctgccgcatcctggtg
acgctgctgcacgaaatgcagcgccagaacgcgaagaagggcattgcctcgctgtgcatc
ggcggcggcatgggcgtggcgctgaccatcgagcgatag

DBGET integrated database retrieval system