KEGG   Variovorax paradoxus B4: VAPA_1c22850Help
Entry
VAPA_1c22850      CDS       T02835                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
vpd  Variovorax paradoxus B4
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vpd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    VAPA_1c22850
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VAPA_1c22850
   00650 Butanoate metabolism
    VAPA_1c22850
  Amino acid metabolism
   00360 Phenylalanine metabolism
    VAPA_1c22850
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VAPA_1c22850
   00622 Xylene degradation
    VAPA_1c22850
   00621 Dioxin degradation
    VAPA_1c22850
Enzymes [BR:vpd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     VAPA_1c22850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2424978..2425919
Genome map
AA seq 313 aa AA seqDB search
MAERKLKAAILGSGNIGTDLMIKILRHGRHVEMGAMVGIDATSDGLARAARMGVATTHEG
VDGLARLPVFEEVDIVFDATSASAHAMHDAFLRKHKPNIRCVDLTPAAIGPYCIPVVNGT
EHLDAINVNMVTCGGQATIPIVAAVSRVAKVHYAEIVASISSKSAGPGTRANIDEFTETT
AKAIEVVGGARKGKAIIVLNPADPPLIMRDTVYTLSEAADERQIAASVEETVAAVNRYVP
GYRLKQQVQFDRVENLKVPGVGCISGLKTTIFLEVEGAAHYLPAYAGNLDIMTSAALATA
ERMAERILEGATA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacgtaaactcaaagccgccatcctgggcagcgggaacatcggcacggacttg
atgatcaagattctgcgccacggccggcacgtcgagatgggtgcgatggtggggatcgac
gccacttccgatggtctcgcccgcgcagcgcgaatgggtgtcgccaccacgcacgaaggt
gtcgacgggcttgcgcggcttccggtattcgaagaagtcgacatcgtgttcgatgccaca
tccgcctcggcccatgccatgcacgacgcattcctgcgcaagcacaagccgaacattcgc
tgtgtcgacctgacgccggccgccatcgggccttactgcattcccgtcgtgaacggcacg
gaacacctggatgcgataaacgtcaacatggtgacctgcggcggccaggcaacgatcccg
atcgtcgccgcggtcagcagggttgccaaggtccactatgcggagatcgtcgcctcgatc
tccagcaagagtgcgggcccaggcacgcgcgccaacatcgacgagttcactgaaaccacg
gccaaggccattgaagtggtcggcggcgctcgcaagggcaaggcgatcatcgtcctcaat
cctgccgacccgccgctgatcatgcgcgatacggtctacacgctgagcgaagccgcggac
gagcgccagattgccgcgagcgtggaagaaaccgtggctgcggtgaatcgctacgtgccg
gggtatcgcctgaagcaacaagtgcagttcgatcgcgtggagaacctcaaggtgcccggc
gttggttgcatctccggcctgaagaccactatttttctcgaggtcgagggtgccgcccac
tacctccccgcctatgcgggcaacctggacatcatgaccagcgccgcgcttgccacggcg
gagcgcatggccgaacgcatcctggaaggggcgacagcatga

DBGET integrated database retrieval system