KEGG   Variovorax paradoxus B4: VAPA_1c49620Help
Entry
VAPA_1c49620      CDS       T02835                                 

Definition
bifunctional P-450/NADPH-P450 reductase (EC:1.14.14.1 1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
vpd  Variovorax paradoxus B4
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:vpd00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:vpd00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:vpd00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:5236433..5239663
Genome map
AA seq 1076 aa AA seqDB search
MAGKNSLHPIPHPAKKPFVGNLLSIGSDSPVLDMWKIAQDLGGIYWLDMPGMPVIVVSSP
ALVDELCEEARFDKSTRGALRRLRAASHGLFTSDTHEETWSKPHNILLANFSQRAMQAYH
PMMLDIAGQLVTKWERLNFDEEVDVVRDMTALTLDTIGLCGFGYRFNSFYREGFHPFVDA
MVRTLETVQNRRGLPLEEFMLKKELAQQRKDIRFMHKMVEDIIEERRAGGADIATKPDLL
SYMIAGVDKKSGEKLTDKMIRDECIEFLIAGHETTSGLLSFAIYFLLKNPEALARAQAEV
DNVFGPDTSQKPTYAQVNRLQYVMQVLKEALRLYPTAPAIAMRAKEDTTIGGQYTIKKKN
MVIMHALALHRDKGIWGEDADAFNPDHFSREAERERPVNAFKPFGNGQRACIGRQFALQE
AVLTLGMILQRFDLVDHTGYKLRIKEALTIKPEGLKIKALLRDPATRARGNGAHVEAAVA
PSASTKQAARKPQAARHGTSLLVLQGSNLGTAEDLARQLAEAGELRGFSTQVASLDDYAE
RLPANGAIAIVCASYNGVAPDNAAEFHRWLDKADDSLNGVRFSVFGCGNTDWAATYQAVP
RRIDERLEALGAMRVHPRGEGDAREDMDGAFQDWSDALWPELVKAFGIQSGADTPAEAEP
LYTLEELPPPQKNALVDALGAVALRVIENRELQKNPGGAGEAGRSTRHVELMLPEGVNYR
AGDHLSVVPRNSPAQVERAMARFGFDRSAHVRLHADPGRKTALPVDQVMAVDRLLGDYVE
LQDVATRKQIATLAAYTECPVTRPKLAALSGSDEASQAAYRAEVLHKRKSLLDLLEEHRA
CQLPFAVFLEMLSPLSPRYYSISSSPAMTPGRCSVTVGVVSAPALSGNGTFEGVCSNYLA
RAEAGDTVHGVIRETTAEGFRLPEDAQRPLVMIGPGTGLAPFRGFLQERAAQVERGEALG
DAMLFFGCRHPEQDFIYAEELEAWSHRGLMTLHTAFSRASERKVYVQDLIREQGAAVWKL
LEAGAVIYVCGDGSRMEPDVRRTLADLAREHGHDGAAWMDRMIADQRYVLDVWAGA
NT seq 3231 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaaaaactcgctccatccgatcccgcatcccgcaaagaaaccgttcgtcggc
aacctgctgtcgatcggctccgactcccccgtgctcgacatgtggaagatcgcgcaggac
ctcggcggcatctactggctcgacatgccgggcatgccggtgatcgtggtgtcgtcgccc
gcgctggtcgacgagctttgcgaagaggcgcgcttcgacaagagcacgcgcggcgcgctg
cggcgccttcgcgcggcatcgcacgggctcttcacctccgacacgcacgaggagacctgg
tcgaagccgcacaacatcctgctggccaacttcagccagcgcgccatgcaggcctaccac
ccgatgatgctggacatcgcgggccagctggtcaccaagtgggagcgcctgaacttcgac
gaagaggtggacgtggtgcgcgacatgacggcgctcacgctcgacaccatcggcctgtgc
ggtttcggctaccgcttcaattcgttctaccgcgagggcttccatcccttcgtcgatgcg
atggtgcgcacgctggagacggtgcagaaccgccgcggcctgccgctcgaagagttcatg
ctcaagaaggagctcgcgcagcagcgcaaggacatccgcttcatgcacaagatggtggaa
gacatcatcgaggagcgccgcgcgggcggggccgacattgccaccaagcccgacctgctg
agctacatgatcgcgggcgtggacaagaagagcggcgagaagctcaccgacaagatgatc
cgcgacgagtgcatcgaattcctgatcgcggggcacgagaccaccagcggcctgctctcg
ttcgcgatctacttcctgctcaagaaccccgaggcgctggccagggcgcaggccgaggtc
gacaacgtgttcgggcccgacacctcgcagaagccgacctatgcgcaggtcaaccgcctg
cagtacgtcatgcaggtgctgaaggaggcgctgcgcctgtacccgaccgcccccgccatc
gcgatgcgcgcgaaggaagacacgaccatcggcggccagtacacgatcaagaagaagaac
atggtcatcatgcacgcgctggcgctgcatcgcgacaagggcatctggggcgaagacgcc
gacgcgttcaaccccgaccacttcagccgcgaggccgagcgcgagcggccggtgaatgcc
ttcaagcccttcggcaacgggcagcgcgcctgcatcgggcgccagttcgcattgcaggag
gcggtgctcacgctgggcatgatcctgcagcgcttcgacctcgtcgaccacacgggctac
aagctcaggatcaaggaggcgctcacgatcaagccggaaggcctgaagatcaaggcactg
ctgcgcgacccggccacgcgcgcccgcggcaatggcgcccacgtggaggcggcggttgcg
ccgtccgcttccacgaaacaggccgcgcgcaagccgcaggccgcgcgccacggcacctcg
ctgctggtgctgcagggctccaacctcggcacggccgaagacctggcgcgccagctggcc
gaggccggcgagctgcgtggcttctcgacgcaggtggcttcgctcgacgactacgccgag
cggctgcccgccaatggcgccatcgccatcgtctgcgcctcgtacaacggcgtggcgccc
gacaacgccgccgagttccatcgctggctcgacaaggccgacgattcgctcaatggcgtg
cgcttcagcgtcttcggctgcggcaacaccgactgggccgccacctaccaggcggtaccg
cggcgcatcgacgagcggctcgaggcgctcggcgccatgcgcgtgcatccgcgcggcgag
ggcgatgcgcgcgaggacatggacggcgccttccaggactggagcgacgcgctctggccc
gaactggtgaaggccttcggcatccagtccggcgccgacacgcccgccgaggccgagccg
ctctacacgctcgaggaactgccgccgccgcagaagaacgcactcgtcgacgcgctgggc
gcggtggccctgcgcgtgatcgagaaccgcgagctgcagaagaaccccggcggcgccggc
gaagcgggccgctccacgcgccacgtcgagctgatgctgcccgaaggcgtgaactaccgc
gccggcgaccacctgagcgtggtgccgcgcaacagcccggcccaggtggagcgcgccatg
gcgcgcttcggattcgaccgctcggcgcatgtgcggctgcatgccgatccgggccgcaag
acggccctgccggtcgaccaggtgatggcggtcgaccgcctgctcggcgactatgtcgag
ctgcaggacgtggccacgcgcaagcagatcgccacgctcgcggcatacaccgagtgcccg
gtcaccaggccgaagctcgccgcgctctcgggcagcgacgaagcctcgcaggcggcctac
agggccgaggtgctgcacaagcgcaagtcgctgctcgacctgctcgaggaacaccgcgcc
tgccagctgccgttcgcggtgttcctcgaaatgctgtcgccgctctcgccgcgctactac
tcgatctcgtcgtcgccggcgatgacgccggggcgctgcagcgtcaccgtgggcgtggtc
agcgcgccggcgctctcgggcaacggcaccttcgagggcgtgtgctccaactacctggcg
cgcgccgaagcgggcgacacggtgcacggcgtcattcgcgagaccacggccgaaggtttc
cgcctgcccgaggatgcgcagcggccgctcgtcatgatcggccccggcaccggcctcgcg
ccgttccgcggcttcctgcaggagcgcgcggcgcaggtcgagcgcggcgaagcactgggc
gacgcgatgctgttcttcggctgccgccatcccgagcaggatttcatctatgccgaggag
ctcgaggcctggtcgcaccgcggcctgatgacgctgcacacggcgttctcgcgcgccagc
gagcgcaaggtctatgtgcaggacctgatccgcgagcagggcgcggccgtgtggaagctg
ctggaagcgggcgcggtgatctatgtatgcggcgacggttcgcgcatggagcccgacgtg
cggcgcacgctggccgacctggcgcgcgagcatggccatgacggcgcggcgtggatggac
cgcatgattgccgaccagcgctatgtgctcgacgtctgggcaggggcctag

DBGET integrated database retrieval system