KEGG   Variovorax paradoxus B4: VAPA_1c49620Help
Entry
VAPA_1c49620      CDS       T02835                                 

Definition
bifunctional P-450/NADPH-P450 reductase (EC:1.14.14.1 1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
vpd  Variovorax paradoxus B4
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vpd00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    VAPA_1c49620
  Amino acid metabolism
   00380 Tryptophan metabolism
    VAPA_1c49620
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    VAPA_1c49620
Enzymes [BR:vpd01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     VAPA_1c49620
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     VAPA_1c49620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:5236433..5239663
Genome map
AA seq 1076 aa AA seqDB search
MAGKNSLHPIPHPAKKPFVGNLLSIGSDSPVLDMWKIAQDLGGIYWLDMPGMPVIVVSSP
ALVDELCEEARFDKSTRGALRRLRAASHGLFTSDTHEETWSKPHNILLANFSQRAMQAYH
PMMLDIAGQLVTKWERLNFDEEVDVVRDMTALTLDTIGLCGFGYRFNSFYREGFHPFVDA
MVRTLETVQNRRGLPLEEFMLKKELAQQRKDIRFMHKMVEDIIEERRAGGADIATKPDLL
SYMIAGVDKKSGEKLTDKMIRDECIEFLIAGHETTSGLLSFAIYFLLKNPEALARAQAEV
DNVFGPDTSQKPTYAQVNRLQYVMQVLKEALRLYPTAPAIAMRAKEDTTIGGQYTIKKKN
MVIMHALALHRDKGIWGEDADAFNPDHFSREAERERPVNAFKPFGNGQRACIGRQFALQE
AVLTLGMILQRFDLVDHTGYKLRIKEALTIKPEGLKIKALLRDPATRARGNGAHVEAAVA
PSASTKQAARKPQAARHGTSLLVLQGSNLGTAEDLARQLAEAGELRGFSTQVASLDDYAE
RLPANGAIAIVCASYNGVAPDNAAEFHRWLDKADDSLNGVRFSVFGCGNTDWAATYQAVP
RRIDERLEALGAMRVHPRGEGDAREDMDGAFQDWSDALWPELVKAFGIQSGADTPAEAEP
LYTLEELPPPQKNALVDALGAVALRVIENRELQKNPGGAGEAGRSTRHVELMLPEGVNYR
AGDHLSVVPRNSPAQVERAMARFGFDRSAHVRLHADPGRKTALPVDQVMAVDRLLGDYVE
LQDVATRKQIATLAAYTECPVTRPKLAALSGSDEASQAAYRAEVLHKRKSLLDLLEEHRA
CQLPFAVFLEMLSPLSPRYYSISSSPAMTPGRCSVTVGVVSAPALSGNGTFEGVCSNYLA
RAEAGDTVHGVIRETTAEGFRLPEDAQRPLVMIGPGTGLAPFRGFLQERAAQVERGEALG
DAMLFFGCRHPEQDFIYAEELEAWSHRGLMTLHTAFSRASERKVYVQDLIREQGAAVWKL
LEAGAVIYVCGDGSRMEPDVRRTLADLAREHGHDGAAWMDRMIADQRYVLDVWAGA
NT seq 3231 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaaaaactcgctccatccgatcccgcatcccgcaaagaaaccgttcgtcggc
aacctgctgtcgatcggctccgactcccccgtgctcgacatgtggaagatcgcgcaggac
ctcggcggcatctactggctcgacatgccgggcatgccggtgatcgtggtgtcgtcgccc
gcgctggtcgacgagctttgcgaagaggcgcgcttcgacaagagcacgcgcggcgcgctg
cggcgccttcgcgcggcatcgcacgggctcttcacctccgacacgcacgaggagacctgg
tcgaagccgcacaacatcctgctggccaacttcagccagcgcgccatgcaggcctaccac
ccgatgatgctggacatcgcgggccagctggtcaccaagtgggagcgcctgaacttcgac
gaagaggtggacgtggtgcgcgacatgacggcgctcacgctcgacaccatcggcctgtgc
ggtttcggctaccgcttcaattcgttctaccgcgagggcttccatcccttcgtcgatgcg
atggtgcgcacgctggagacggtgcagaaccgccgcggcctgccgctcgaagagttcatg
ctcaagaaggagctcgcgcagcagcgcaaggacatccgcttcatgcacaagatggtggaa
gacatcatcgaggagcgccgcgcgggcggggccgacattgccaccaagcccgacctgctg
agctacatgatcgcgggcgtggacaagaagagcggcgagaagctcaccgacaagatgatc
cgcgacgagtgcatcgaattcctgatcgcggggcacgagaccaccagcggcctgctctcg
ttcgcgatctacttcctgctcaagaaccccgaggcgctggccagggcgcaggccgaggtc
gacaacgtgttcgggcccgacacctcgcagaagccgacctatgcgcaggtcaaccgcctg
cagtacgtcatgcaggtgctgaaggaggcgctgcgcctgtacccgaccgcccccgccatc
gcgatgcgcgcgaaggaagacacgaccatcggcggccagtacacgatcaagaagaagaac
atggtcatcatgcacgcgctggcgctgcatcgcgacaagggcatctggggcgaagacgcc
gacgcgttcaaccccgaccacttcagccgcgaggccgagcgcgagcggccggtgaatgcc
ttcaagcccttcggcaacgggcagcgcgcctgcatcgggcgccagttcgcattgcaggag
gcggtgctcacgctgggcatgatcctgcagcgcttcgacctcgtcgaccacacgggctac
aagctcaggatcaaggaggcgctcacgatcaagccggaaggcctgaagatcaaggcactg
ctgcgcgacccggccacgcgcgcccgcggcaatggcgcccacgtggaggcggcggttgcg
ccgtccgcttccacgaaacaggccgcgcgcaagccgcaggccgcgcgccacggcacctcg
ctgctggtgctgcagggctccaacctcggcacggccgaagacctggcgcgccagctggcc
gaggccggcgagctgcgtggcttctcgacgcaggtggcttcgctcgacgactacgccgag
cggctgcccgccaatggcgccatcgccatcgtctgcgcctcgtacaacggcgtggcgccc
gacaacgccgccgagttccatcgctggctcgacaaggccgacgattcgctcaatggcgtg
cgcttcagcgtcttcggctgcggcaacaccgactgggccgccacctaccaggcggtaccg
cggcgcatcgacgagcggctcgaggcgctcggcgccatgcgcgtgcatccgcgcggcgag
ggcgatgcgcgcgaggacatggacggcgccttccaggactggagcgacgcgctctggccc
gaactggtgaaggccttcggcatccagtccggcgccgacacgcccgccgaggccgagccg
ctctacacgctcgaggaactgccgccgccgcagaagaacgcactcgtcgacgcgctgggc
gcggtggccctgcgcgtgatcgagaaccgcgagctgcagaagaaccccggcggcgccggc
gaagcgggccgctccacgcgccacgtcgagctgatgctgcccgaaggcgtgaactaccgc
gccggcgaccacctgagcgtggtgccgcgcaacagcccggcccaggtggagcgcgccatg
gcgcgcttcggattcgaccgctcggcgcatgtgcggctgcatgccgatccgggccgcaag
acggccctgccggtcgaccaggtgatggcggtcgaccgcctgctcggcgactatgtcgag
ctgcaggacgtggccacgcgcaagcagatcgccacgctcgcggcatacaccgagtgcccg
gtcaccaggccgaagctcgccgcgctctcgggcagcgacgaagcctcgcaggcggcctac
agggccgaggtgctgcacaagcgcaagtcgctgctcgacctgctcgaggaacaccgcgcc
tgccagctgccgttcgcggtgttcctcgaaatgctgtcgccgctctcgccgcgctactac
tcgatctcgtcgtcgccggcgatgacgccggggcgctgcagcgtcaccgtgggcgtggtc
agcgcgccggcgctctcgggcaacggcaccttcgagggcgtgtgctccaactacctggcg
cgcgccgaagcgggcgacacggtgcacggcgtcattcgcgagaccacggccgaaggtttc
cgcctgcccgaggatgcgcagcggccgctcgtcatgatcggccccggcaccggcctcgcg
ccgttccgcggcttcctgcaggagcgcgcggcgcaggtcgagcgcggcgaagcactgggc
gacgcgatgctgttcttcggctgccgccatcccgagcaggatttcatctatgccgaggag
ctcgaggcctggtcgcaccgcggcctgatgacgctgcacacggcgttctcgcgcgccagc
gagcgcaaggtctatgtgcaggacctgatccgcgagcagggcgcggccgtgtggaagctg
ctggaagcgggcgcggtgatctatgtatgcggcgacggttcgcgcatggagcccgacgtg
cggcgcacgctggccgacctggcgcgcgagcatggccatgacggcgcggcgtggatggac
cgcatgattgccgaccagcgctatgtgctcgacgtctgggcaggggcctag

DBGET integrated database retrieval system