KEGG   Variovorax paradoxus B4: VAPA_2c03840Help
Entry
VAPA_2c03840      CDS       T02835                                 

Definition
putative thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
vpd  Variovorax paradoxus B4
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:vpd00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:384231..385739
Genome map
AA seq 502 aa AA seqDB search
MSSPNRLLARRAGIDTYQQPVVYMRSDCDVCRAEGFQSQAQVELIANGRHLFAILHQVSG
DWLRNDEIALSEAAWTLMGAAEGEELVVRHPPILDSLAHLRNKVHGGRLDYAALRALMED
VSRGRLPDIHLASFVTVCAGRGLDLDETVALTRAMVDVGERIDWGTSPVMDKHCIGGLPG
NRTTLLVVPIIAACGLVMPKTSSRAITSAAGTADVMETLAPVDLDLAAMRRVVEREGGCI
AWGSAMRVSPADDMLIRVERPLGIDSEGLMVASILSKKAAMGSQRVLIDIPVGALAKVRS
DEAASQLSRSLVSVGAALGLHVRTVFTDGNQPVGRGVGPALEAMDVMAVLERTADAPSDL
RERALLLAGLLLELAGKAAPGTGNALARAVLEDGRALARFIAICEAQGGLRVPPKAAHTH
CVTAPAAGVVSGIDTRLVARMAKLAGAPRDPAAGASMHVRVQDRVDRGQPLFTLHAESLG
ELQYALSFVRSQLPVVRIEAAP
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcacccaaccgcctgctggcccgccgcgccggcatcgacacctaccagcagccc
gtggtctacatgcgcagcgactgcgatgtctgccgggcggagggcttccagtcgcaggcg
caggtcgagctgatcgccaacgggcgccatctgttcgcgatcctgcaccaggtgagcggc
gactggctgcgcaatgacgagatcgcgctgtcggaggcggcctggaccttgatgggcgcc
gccgagggcgaagagctggtggtgcggcacccgccgatcctcgattcgctggcgcacctg
cgcaacaaggtgcatggcggcaggctggactacgctgcgctgcgcgcgctgatggaggac
gtgagccgcgggcgcctccccgacatccacctggcctccttcgtgacggtctgcgccggc
cgcggcctcgacctggacgagaccgtggcgctgacccgcgccatggtcgacgtcggggag
cgcatcgactggggcacgtcgcccgtgatggacaagcactgcatcggcggcttgccgggc
aaccggaccacgctgctggtggtgccgatcattgcggcctgcggcctggtgatgcccaag
acctcgtcgcgcgccatcacctcggcggccggcacggccgacgtgatggaaacgctcgcg
ccggtcgacctggacctggcggcaatgcgccgcgtggtcgagcgcgaaggcggctgcatc
gcatggggaagcgccatgcgcgtgagtcccgcggacgacatgctgatccgcgtggagcgg
ccgctcggcatcgacagcgagggcctcatggtggcgtccatcctgtccaagaaggctgcg
atgggttcgcagcgcgtgctgatcgacattccggtcggcgcgctggccaaggtgcgcagc
gacgaggccgccagccagctctcgcgcagcctggtctcggtgggcgcggcgctgggcctg
cacgtgcggacggtgttcaccgacggcaaccagccggtcggccgcggcgtcggccccgcg
ctcgaggcgatggatgtgatggcggtgctcgaacgcaccgccgacgcgccgtcggacctg
cgcgagcgcgcgctcctgctggccgggctgctgctcgaactggcgggcaaggcggcgccg
ggcaccggcaacgcgctggcgcgcgcggtcctggaggacgggcgcgcgctcgcccgcttc
attgcgatctgcgaagcacagggcggcctgcgcgtgccgccgaaagccgcccacacgcac
tgcgtgaccgcgcccgcggccggggtggtgtcgggcatcgacacccgcctggtggcgcgc
atggccaagctggccggtgcgccgcgcgatccggcggcgggtgcctcgatgcacgtgcgc
gtgcaggaccgcgtcgatcgcggccagccgctcttcacattgcatgccgagagcctcggc
gagcttcagtacgccttgagcttcgtgcgctcgcagctgccggtcgttcgcatcgaggct
gcgccctga

DBGET integrated database retrieval system