KEGG   Variovorax paradoxus EPS: Varpa_0038Help
Entry
Varpa_0038        CDS       T01392                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
vpe  Variovorax paradoxus EPS
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(41268..42128)
Genome map
AA seq 286 aa AA seqDB search
MSARDASDELSLVPPEVQRTAVVLLHGLCSTPDELLTVQSALRARGYAAHPLSIDGYSFD
ANAPMQRAAPYERWLDAIQAQVKALRKQHDRVMLVGISAGSSLALGAAIRCGRDVDALVL
MSTTLRFDGWAIPRTQFLLPLAFYTPLGRLWQYRERPPYGVKNERVRAWIERELRHRKIS
RAGCSVLGVDHLREHDRLIRHVRRNLNAVQCDNVLALHAQQDEVASVANLGILARGLRCR
AFRTVVVANSYHMITIDNDRQQVVRETVSFADAVAHGTMPAHPLYA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacgtgacgcctccgatgagctgagtctggttccccccgaggtgcaacgcacc
gcggtggtcctcctgcatggtttatgcagcacgcctgacgagctgctgaccgtgcaatcg
gcattgcgcgcccgggggtatgcggcccatccgctgtcgatcgatggctactccttcgat
gccaacgcgccaatgcagcgagccgcgccgtacgaacgctggctcgacgccatccaggcc
caggtgaaggcgctgcgcaagcagcacgaccgcgtgatgctggtcggcatctccgccggc
tcctcgctcgcgctgggcgcggccatccgctgcggccgcgatgtcgatgcgctggtgctc
atgtcgaccacgctgcgcttcgacggctgggcgattccgcgcacgcagttcctgctgccg
ctcgccttctacacgccgctcgggcgcctctggcaataccgcgagcggccgccctacggt
gtgaagaacgaacgcgtgcgcgcctggatcgagcgcgaactgcgccaccgcaagatctcg
cgcgcgggctgctcggtgctcggcgtggatcatctgcgcgaacacgaccggttgattcgc
catgtgcggcgcaacctgaacgccgtgcagtgcgacaacgtgctcgcgctgcatgcccag
caggacgaggtggccagcgtggccaacctgggcatcctcgcgcgcggcctgcgctgccgc
gcattccgcaccgtggtcgtggccaacagctaccacatgatcacgatcgacaacgaccgc
cagcaggtcgtgcgcgaaaccgtgtcgttcgccgatgcggtcgcacacggcacgatgccc
gcgcatcccctgtacgcatga

DBGET integrated database retrieval system