KEGG   Variovorax paradoxus EPS: Varpa_0215Help
Entry
Varpa_0215        CDS       T01392                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:vpe00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
228097..228822
Genome map
AA seq 241 aa AA seqDB search
MHRRIVLKSAAALGLVSGLGSFGLSAFAAGKIKPGAKAALIVVDVQNCFLDGGTLAVKGG
NEVIPVINGLAPAFENIVVTQDWHTAGHASFASTYSGKKPFETTKLNYGTQVLWPDHCVQ
GTEDAALGKALKVPTAQLIIRKGFHKEMDSYSAFEEADHKTATGLAGYLKARGIKTVFVT
GLATDFCVAWTAMDARKAGFEAYVIEDATRGIDLNGSLAAAWKQMSAKGVKRIQSADIQT
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgcagaatcgtcttgaagtccgcagcagcccttgggctcgtgagcgggctcggc
agcttcggcctctccgccttcgcggccggaaagatcaagcctggtgccaaggccgcgctg
atcgtggtcgatgtgcagaactgttttctcgatggcggcacgctcgcggtgaagggcggc
aacgaggtgatcccggtcatcaacggcctcgcgcccgcgttcgagaacatcgtcgtcacg
caggactggcacaccgcaggtcatgcgtcgttcgcgagcacctactcgggcaagaagcct
ttcgagacgaccaagctcaactacggcacgcaggtgctgtggcccgaccactgcgtgcaa
ggcaccgaagacgccgcgctcggcaaggcgctgaaggtgcccaccgcgcagctcatcatc
cgcaagggctttcataaagagatggacagctactccgccttcgaggaagccgaccacaag
acggcgaccggccttgccggctacctcaaggcgcgcggcatcaagaccgtgttcgtcacg
ggtctggccaccgacttctgcgtggcctggaccgcgatggacgcgcgcaaggccggcttc
gaggcctacgtgatcgaagacgccacgcgcggcatcgacctcaacggctcgctcgccgcc
gcatggaagcagatgagtgccaaaggcgtcaagcgcatccagtcggcggacatccagacc
gcctga

DBGET integrated database retrieval system