KEGG   Variovorax paradoxus EPS: Varpa_0215Help
Entry
Varpa_0215        CDS       T01392                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Varpa_0215
Enzymes [BR:vpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Varpa_0215
    3.5.1.-  
     Varpa_0215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
228097..228822
Genome map
AA seq 241 aa AA seqDB search
MHRRIVLKSAAALGLVSGLGSFGLSAFAAGKIKPGAKAALIVVDVQNCFLDGGTLAVKGG
NEVIPVINGLAPAFENIVVTQDWHTAGHASFASTYSGKKPFETTKLNYGTQVLWPDHCVQ
GTEDAALGKALKVPTAQLIIRKGFHKEMDSYSAFEEADHKTATGLAGYLKARGIKTVFVT
GLATDFCVAWTAMDARKAGFEAYVIEDATRGIDLNGSLAAAWKQMSAKGVKRIQSADIQT
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgcagaatcgtcttgaagtccgcagcagcccttgggctcgtgagcgggctcggc
agcttcggcctctccgccttcgcggccggaaagatcaagcctggtgccaaggccgcgctg
atcgtggtcgatgtgcagaactgttttctcgatggcggcacgctcgcggtgaagggcggc
aacgaggtgatcccggtcatcaacggcctcgcgcccgcgttcgagaacatcgtcgtcacg
caggactggcacaccgcaggtcatgcgtcgttcgcgagcacctactcgggcaagaagcct
ttcgagacgaccaagctcaactacggcacgcaggtgctgtggcccgaccactgcgtgcaa
ggcaccgaagacgccgcgctcggcaaggcgctgaaggtgcccaccgcgcagctcatcatc
cgcaagggctttcataaagagatggacagctactccgccttcgaggaagccgaccacaag
acggcgaccggccttgccggctacctcaaggcgcgcggcatcaagaccgtgttcgtcacg
ggtctggccaccgacttctgcgtggcctggaccgcgatggacgcgcgcaaggccggcttc
gaggcctacgtgatcgaagacgccacgcgcggcatcgacctcaacggctcgctcgccgcc
gcatggaagcagatgagtgccaaaggcgtcaagcgcatccagtcggcggacatccagacc
gcctga

DBGET integrated database retrieval system