KEGG   Variovorax paradoxus EPS: Varpa_0462Help
Entry
Varpa_0462        CDS       T01392                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00010  Glycolysis / Gluconeogenesis
vpe00030  Pentose phosphate pathway
vpe00051  Fructose and mannose metabolism
vpe00052  Galactose metabolism
vpe00680  Methane metabolism
vpe01100  Metabolic pathways
vpe01110  Biosynthesis of secondary metabolites
vpe01120  Microbial metabolism in diverse environments
vpe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Varpa_0462
   00030 Pentose phosphate pathway
    Varpa_0462
   00051 Fructose and mannose metabolism
    Varpa_0462
   00052 Galactose metabolism
    Varpa_0462
  Energy metabolism
   00680 Methane metabolism
    Varpa_0462
Enzymes [BR:vpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Varpa_0462
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Varpa_0462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ADU34684
JGI: Varpa_0462
UniProt: E6V4D8
Position
complement(501141..502421)
Genome map
AA seq 426 aa AA seqDB search
MGLRENARMPILNAFYAQSGGVTSVINASACGVIETARKHPDRIGKLYAGRNGIIGALTE
ELIDTGAESAEAIAALRTTPSGAFGSCRYKLKSLEKNRREYERLIEVFKAHGIGYFFYNG
GGDSADTCFKVSQLSQSLGYPLQAIHVPKTIDNDLPLTDCCPGFGSVAKYVAVSTIEASF
DVRSMAATSTKVFVLEVMGRHAGWIAAAGGLAADQGIPVVVLFPEIEFDKPRFLARVDEL
VKQHGYCSVVVSEGCHYPDGTFLAEQGTRDAFGHAQLGGAAPVVAQMIKDAYGHKFHWAV
ADYLQRAARHIASATDVKQAYELGQRAVELALEGRNAVMPTIERTSDVPYAYTLGSAPLE
SVANVEKPMPRDFISDDGYGITEKCRRYLLPLIEGEDYPAYRNGLPVYVTLQNVAVAKKL
PAFELA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggggctgcgggagaatgcccgcatgcccatcctcaacgccttctacgcccagtcgggc
ggcgtcacctcggtcatcaatgcgtcggcctgcggcgtgatcgagacggcacgaaaacac
ccggaccgcatcggcaagctctacgccggccgcaacggcatcatcggcgcgctgacggaa
gaactgatcgacacgggcgccgaatcggccgaagcgattgcggccttgcgaaccacgcca
tcgggcgcattcggttcgtgccgctacaagctcaagtcgctcgagaagaaccgccgcgaa
tacgagcggctgatcgaagtcttcaaggcgcacggcatcggctatttcttctacaacggg
ggcggcgattcggccgacacttgcttcaaggtgagccagctctcgcagtcgctcggttat
ccgctgcaggcgatccatgtgcccaagaccatcgacaacgacctgccgctgaccgactgc
tgcccgggcttcggctcggtcgcgaagtacgtggcggtgtcgacgatcgaggcctcgttc
gacgtgcgctcgatggccgccacctcgaccaaggtgttcgtgctcgaagtgatggggcgg
catgcggggtggatcgccgcagccggcgggcttgccgcggaccagggcattccggtggtg
gtgctgtttcctgaaatcgagttcgacaagccgcgctttctcgcgcgtgtcgatgaattg
gtgaagcagcacggctactgctcggtcgtggtgtccgagggctgccactaccccgacggg
accttcctcgcggagcaaggcacgcgcgatgcgttcggccatgcgcagctcggcggcgcg
gcgccagtggtggcgcagatgatcaaggacgcatacggccacaagtttcactgggccgtg
gccgactacctgcagcgcgcggcgcggcacattgcctcggccaccgacgtgaagcaggcc
tacgagctgggacagcgcgccgtcgagctcgcgctggaaggccgcaatgcagtgatgccg
acgatcgagcgcacgtccgatgtgccctatgcgtacacgctcggcagcgcgccgctcgaa
tcggtggccaatgtcgagaagccgatgccgcgcgacttcatttcggacgacggctacggc
atcaccgagaaatgccggcgctacctgctgccgttgatcgagggcgaggactaccccgcc
taccgcaacggcttgccggtgtatgtgacgctgcagaacgtcgcggtggcaaagaagctg
ccggccttcgagctcgcatga

DBGET integrated database retrieval system