KEGG   Variovorax paradoxus EPS: Varpa_0462Help
Entry
Varpa_0462        CDS       T01392                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Varpa_0462
   00030 Pentose phosphate pathway
    Varpa_0462
   00051 Fructose and mannose metabolism
    Varpa_0462
   00052 Galactose metabolism
    Varpa_0462
  Energy metabolism
   00680 Methane metabolism
    Varpa_0462
Enzymes [BR:vpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Varpa_0462
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Varpa_0462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(501141..502421)
Genome map
AA seq 426 aa AA seqDB search
MGLRENARMPILNAFYAQSGGVTSVINASACGVIETARKHPDRIGKLYAGRNGIIGALTE
ELIDTGAESAEAIAALRTTPSGAFGSCRYKLKSLEKNRREYERLIEVFKAHGIGYFFYNG
GGDSADTCFKVSQLSQSLGYPLQAIHVPKTIDNDLPLTDCCPGFGSVAKYVAVSTIEASF
DVRSMAATSTKVFVLEVMGRHAGWIAAAGGLAADQGIPVVVLFPEIEFDKPRFLARVDEL
VKQHGYCSVVVSEGCHYPDGTFLAEQGTRDAFGHAQLGGAAPVVAQMIKDAYGHKFHWAV
ADYLQRAARHIASATDVKQAYELGQRAVELALEGRNAVMPTIERTSDVPYAYTLGSAPLE
SVANVEKPMPRDFISDDGYGITEKCRRYLLPLIEGEDYPAYRNGLPVYVTLQNVAVAKKL
PAFELA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggggctgcgggagaatgcccgcatgcccatcctcaacgccttctacgcccagtcgggc
ggcgtcacctcggtcatcaatgcgtcggcctgcggcgtgatcgagacggcacgaaaacac
ccggaccgcatcggcaagctctacgccggccgcaacggcatcatcggcgcgctgacggaa
gaactgatcgacacgggcgccgaatcggccgaagcgattgcggccttgcgaaccacgcca
tcgggcgcattcggttcgtgccgctacaagctcaagtcgctcgagaagaaccgccgcgaa
tacgagcggctgatcgaagtcttcaaggcgcacggcatcggctatttcttctacaacggg
ggcggcgattcggccgacacttgcttcaaggtgagccagctctcgcagtcgctcggttat
ccgctgcaggcgatccatgtgcccaagaccatcgacaacgacctgccgctgaccgactgc
tgcccgggcttcggctcggtcgcgaagtacgtggcggtgtcgacgatcgaggcctcgttc
gacgtgcgctcgatggccgccacctcgaccaaggtgttcgtgctcgaagtgatggggcgg
catgcggggtggatcgccgcagccggcgggcttgccgcggaccagggcattccggtggtg
gtgctgtttcctgaaatcgagttcgacaagccgcgctttctcgcgcgtgtcgatgaattg
gtgaagcagcacggctactgctcggtcgtggtgtccgagggctgccactaccccgacggg
accttcctcgcggagcaaggcacgcgcgatgcgttcggccatgcgcagctcggcggcgcg
gcgccagtggtggcgcagatgatcaaggacgcatacggccacaagtttcactgggccgtg
gccgactacctgcagcgcgcggcgcggcacattgcctcggccaccgacgtgaagcaggcc
tacgagctgggacagcgcgccgtcgagctcgcgctggaaggccgcaatgcagtgatgccg
acgatcgagcgcacgtccgatgtgccctatgcgtacacgctcggcagcgcgccgctcgaa
tcggtggccaatgtcgagaagccgatgccgcgcgacttcatttcggacgacggctacggc
atcaccgagaaatgccggcgctacctgctgccgttgatcgagggcgaggactaccccgcc
taccgcaacggcttgccggtgtatgtgacgctgcagaacgtcgcggtggcaaagaagctg
ccggccttcgagctcgcatga

DBGET integrated database retrieval system