KEGG   Variovorax paradoxus EPS: Varpa_0462Help
Entry
Varpa_0462        CDS       T01392                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Varpa_0462
   01230 Biosynthesis of amino acids
    Varpa_0462
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Varpa_0462
   00030 Pentose phosphate pathway
    Varpa_0462
   00051 Fructose and mannose metabolism
    Varpa_0462
   00052 Galactose metabolism
    Varpa_0462
  Energy metabolism
   00680 Methane metabolism
    Varpa_0462
Enzymes [BR:vpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Varpa_0462
Protein phosphatases and associated proteins [BR:vpe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Varpa_0462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(501141..502421)
Genome map
AA seq 426 aa AA seqDB search
MGLRENARMPILNAFYAQSGGVTSVINASACGVIETARKHPDRIGKLYAGRNGIIGALTE
ELIDTGAESAEAIAALRTTPSGAFGSCRYKLKSLEKNRREYERLIEVFKAHGIGYFFYNG
GGDSADTCFKVSQLSQSLGYPLQAIHVPKTIDNDLPLTDCCPGFGSVAKYVAVSTIEASF
DVRSMAATSTKVFVLEVMGRHAGWIAAAGGLAADQGIPVVVLFPEIEFDKPRFLARVDEL
VKQHGYCSVVVSEGCHYPDGTFLAEQGTRDAFGHAQLGGAAPVVAQMIKDAYGHKFHWAV
ADYLQRAARHIASATDVKQAYELGQRAVELALEGRNAVMPTIERTSDVPYAYTLGSAPLE
SVANVEKPMPRDFISDDGYGITEKCRRYLLPLIEGEDYPAYRNGLPVYVTLQNVAVAKKL
PAFELA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggggctgcgggagaatgcccgcatgcccatcctcaacgccttctacgcccagtcgggc
ggcgtcacctcggtcatcaatgcgtcggcctgcggcgtgatcgagacggcacgaaaacac
ccggaccgcatcggcaagctctacgccggccgcaacggcatcatcggcgcgctgacggaa
gaactgatcgacacgggcgccgaatcggccgaagcgattgcggccttgcgaaccacgcca
tcgggcgcattcggttcgtgccgctacaagctcaagtcgctcgagaagaaccgccgcgaa
tacgagcggctgatcgaagtcttcaaggcgcacggcatcggctatttcttctacaacggg
ggcggcgattcggccgacacttgcttcaaggtgagccagctctcgcagtcgctcggttat
ccgctgcaggcgatccatgtgcccaagaccatcgacaacgacctgccgctgaccgactgc
tgcccgggcttcggctcggtcgcgaagtacgtggcggtgtcgacgatcgaggcctcgttc
gacgtgcgctcgatggccgccacctcgaccaaggtgttcgtgctcgaagtgatggggcgg
catgcggggtggatcgccgcagccggcgggcttgccgcggaccagggcattccggtggtg
gtgctgtttcctgaaatcgagttcgacaagccgcgctttctcgcgcgtgtcgatgaattg
gtgaagcagcacggctactgctcggtcgtggtgtccgagggctgccactaccccgacggg
accttcctcgcggagcaaggcacgcgcgatgcgttcggccatgcgcagctcggcggcgcg
gcgccagtggtggcgcagatgatcaaggacgcatacggccacaagtttcactgggccgtg
gccgactacctgcagcgcgcggcgcggcacattgcctcggccaccgacgtgaagcaggcc
tacgagctgggacagcgcgccgtcgagctcgcgctggaaggccgcaatgcagtgatgccg
acgatcgagcgcacgtccgatgtgccctatgcgtacacgctcggcagcgcgccgctcgaa
tcggtggccaatgtcgagaagccgatgccgcgcgacttcatttcggacgacggctacggc
atcaccgagaaatgccggcgctacctgctgccgttgatcgagggcgaggactaccccgcc
taccgcaacggcttgccggtgtatgtgacgctgcagaacgtcgcggtggcaaagaagctg
ccggccttcgagctcgcatga

DBGET integrated database retrieval system