KEGG   Variovorax paradoxus EPS: Varpa_0634Help
Entry
Varpa_0634        CDS       T01392                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vpe01100  Metabolic pathways
vpe01110  Biosynthesis of secondary metabolites
vpe01130  Biosynthesis of antibiotics
vpe01230  Biosynthesis of amino acids
Module
vpe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Varpa_0634
Enzymes [BR:vpe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Varpa_0634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADU34855
JGI: Varpa_0634
UniProt: E6V6J2
Position
706341..707141
Genome map
AA seq 266 aa AA seqDB search
MSDILDKIVAVKRQEVAAALKRAPLEAVRFDAESRVLTRDFEAALRAKIAAGQAAVIAEV
KKASPSKGVLREDFIPADIAQSYAEGDGKVSAACLSVLTDKQFFQGGVDYLKQARASCDL
PVLRKDFIIDAYQVYESRAMGADAILLIAACLDDAQMKDYEAIARGLGMAVLVEVHDAAE
LDRALKLKTPLIGVNNRNLRNFEVSIQATIDLLPRLPADRLPVTESGIGTREDVATLRAA
GVNAFLVGEAFMRAKEPGEALAALFE
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcctcgacaagatcgttgccgtcaagcgccaggaagtggcggcggcgctg
aagcgcgcaccgctcgaagccgttcgcttcgacgccgaaagccgcgtgctcacgcgcgat
ttcgaagccgccctgcgcgccaagatcgctgcgggccaggccgccgtgatcgccgaagtc
aagaaagccagcccgagcaagggcgtgctgcgcgaagacttcattccagcggacatcgcg
cagagctacgccgagggtgatggcaaggtcagcgcggcatgcctctcggtgctgacggac
aagcagttcttccagggcggcgtggactatctcaagcaggcccgcgcctcgtgcgacctg
ccggtgctgcgcaaggacttcatcatcgacgcgtaccaggtgtacgagtcgcgcgcgatg
ggcgccgatgccatcctgctgatcgccgcgtgcctggacgatgcgcagatgaaggactac
gaagcgatcgcgcgcgggctcggcatggcggtgctggtggaggtgcacgatgcggccgaa
ctcgatcgcgcgctgaagctcaagacgccgctcatcggggtcaacaaccgcaatctgcgc
aacttcgaggtgtcgatccaggccacgatcgatttgttgccgcggcttccggccgatcgg
ttgccggtgaccgaatcgggtatcggcacgcgcgaagacgttgccacgctgcgtgcggcg
ggcgtcaacgccttcctggtcggtgaagccttcatgcgcgccaaggaacccggcgaggca
ctcgctgcgttgttcgaatga

DBGET integrated database retrieval system