KEGG   Variovorax paradoxus EPS: Varpa_0679Help
Entry
Varpa_0679        CDS       T01392                                 

Definition
signal transduction histidine kinase with cheb and cher activity
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:vpe02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:vpe02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
768478..772590
Genome map
AA seq 1370 aa AA seqDB search
MSDADAALIPSSLNFPVIGIGASAGGLEALLRFFEHLPARAGMAFVVILHLSPKHESSAA
DILQRTTRMKVSQVTRPTPIEVDQVYVIPPGVELTMNDGYLRVAPSERAKGQHVTVDVFF
RTLAEAHRERAVSVVMSGTGSDGAVGLTRIKERGGIAIAQAPADAAHTGMPLAAIATGMV
DIVLPAADIGQRLIDLWTNARQIRMPDAEKIGGFVAPPETQAAAQQAEQALQEIIGLLRT
HTRHDFRHYKRATVLRRIERRLQVNRLTDLPAYRDFLREHPQEAVPLLQDMLISVTNFFR
DRDSFEALERDVLPELVQRKQAGDPLRAWVAGCATGEEAYSLSILLREQADLHARPLEIQ
IFATDIDDRAIATARKAVYAQGIVEDMSPSRLRQFFMKDHDQYRVSTTVREPVLFASHNL
LRDPPFSRLDLICCRNLLIYLDRAAQAHVLEMFRIALKPGGYLFLGTSESIDAVGSLFTP
VDKKNRIFRVNPDLPPGRHMPLISDMPPAPQAGTFVPPRRTSKRTGSERASFAELHQAAL
EQFSPPSVLINAEHEVLHLSNGVGRFLERASGEPSNNLLNNVRPDIRLELRTALFKANQT
ARSVETRLVQRQENGHQVFLNIIVRPLQPAEGESQQLTLVVFDEVEESMRANDGEPVDAA
RELLIGQLEEEIRQLKLHLQDTVESGETSTEELKASNEELQAINEELRSASEELETSKEE
LQSMNEELVTVNFELKVKVEERGHINDDLQNLIASSEIATVFVDRGMHVKRYTPHAGNLF
NLIPSDLGRSLFDITSRLEYPELEEDTAAAFNELRTIERHVPSTDGRHFLARILPYRTAE
DKIEGAILNFFDISELRFAQDKVRAGEERLRLVAATTRDFAIITTDEAGLITTWNAGAQR
IFGYTEEEMLRRPIAVIFTAEDQAHGVPQQEMRRATETGRAADERWHERKDGSRFFCSGV
TSSLDPASGGGFAKIARDMTGTKQQELAQEHRLFKEKQANLSAQMANELKDKFLAVMSHE
LKQPLNLIQMNAELLMHLPAAAQIPAVQRVGETIKRAVASQTRIINDLLDLSRIRTGKLR
LSRVTVDLGELVQSVAQAAVADAPKKKLLLETHCDEAVHCHGDRVRVEQIAWNLLSNAVK
FTPDGGRISVRVETEGDFARLTVADTGCGIAAEFLPHVFGMFNQADGDTALPNGGLGIGL
ALVQELALAHGGRAEVKSAGPGEGAEFTVWLPGSGATDRPAKNVPHAEVSFGGWRILAVD
DYVDALAPFAEVLRLEGAVVDVADSARKGLELLDANTYDLLVSDLGMPEMDGYQFIAEVR
KRPATRALHAIAMSGFGRRADARRALEAGFNAHLPKPASIEELKAAIARL
NT seq 4113 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgcggatgcggcccttatcccgagctcgctgaatttcccggtcatcggcatc
ggcgcatcggcgggcggtctcgaggcactgctgcgtttcttcgagcaccttcccgcgcgt
gccggcatggccttcgtggtgatccttcacctgtcgcccaagcacgaaagcagcgccgcc
gacatcctgcagcgcacgacgcgcatgaaggtgtcgcaggtgaccaggcccacgccgatc
gaagtcgaccaggtctacgtgatcccgcccggggtcgagctgacgatgaacgacggttac
ctgcgcgtcgcgccgagcgagcgcgcaaagggccagcatgtgacggtggacgtcttcttc
cgcacgctggccgaagcccaccgcgaacgcgcggtgtcggtcgtgatgtcgggcaccggc
agcgacggggcggtcgggctcacgcgcatcaaggagcgcggcggcatcgcgatcgcgcag
gcgccggccgatgcggcgcacaccggcatgccgctggcggccatcgccaccggcatggtc
gacatcgtgctgccggccgcggacatcggccagcggctgatcgatctctggaccaacgcc
cgccagatccggatgcccgatgccgagaagatcggcgggttcgtcgcaccgcccgaaacg
caggcggctgcccagcaggcggagcaggcactgcaggaaatcatcggcctgctgcgcacc
cacacccggcacgacttcaggcactacaagcgggccaccgtgctgcgccgcatcgaacgc
aggctgcaggtgaaccggctgacggacctgccggcgtaccgggatttcctgcgcgagcat
ccgcaggaggccgtgccgctgctgcaggacatgctcatcagcgtgaccaacttctttcgc
gaccgcgactccttcgaggcgctggagcgcgatgtgctgccggaactggtgcagcgcaag
caggcgggcgacccgctgcgtgcctgggtcgcgggctgcgccaccggcgaggaagcctat
tcgctgagcatcctgctgcgcgagcaggcggacctgcacgcgcggccgctggagatccag
atcttcgccaccgacatcgacgaccgcgccatcgccaccgcgcgcaaggcggtctatgcg
caaggcatcgtggaagacatgtcgccctcgcggctgcggcagttcttcatgaaggaccat
gaccagtaccgcgtatcgaccacggtgcgcgagccggtgctgttcgcatcgcacaacctg
ctgcgcgatccgccgttctcgcggctggacctgatctgctgccgcaacctgctgatttat
ctggaccgcgccgcgcaggcccatgtgctggagatgttccgcatcgcgctcaagccgggc
ggctacctgttcctgggcacctccgaatcgatcgatgcggtcggcagcctcttcacgccg
gtcgacaagaagaaccgcatcttccgcgtcaatcccgacctgccgcccgggcgccacatg
ccgctgatcagcgacatgccacccgcgccgcaggccggcaccttcgtgccgccgcgccgg
acctccaagcgcaccggctccgagcgtgcgagcttcgcggaactgcaccaggcggcgctg
gagcagttctcgccgcccagcgtgctgatcaacgccgagcacgaggtgctgcacctgtcg
aacggtgtcgggcgcttcctggaacgcgcgagcggcgagccttcgaacaaccttttgaac
aacgtgcgcccggacattcgcctggagctgcgtacggcgctcttcaaggcgaaccagacg
gcgcgcagcgtggaaacacggctggtgcagcggcaggagaacgggcaccaggtctttctg
aacatcatcgtgaggccgctgcagcccgcggagggcgagtcgcagcagctcacgctggtc
gtcttcgacgaggtcgaggaaagcatgcgcgcgaacgacggcgagccggtcgacgcggcg
cgcgaactgctgatcgggcagctcgaggaagagatacgccagctcaagctgcacctgcag
gacaccgtcgagagcggggaaacctccaccgaggaactcaaggcctcgaatgaggaactg
caggccatcaacgaggagctgcgttcggccagcgaggaactggagacgagcaaggaggag
ctccagtcgatgaacgaggagctggtgacggtcaacttcgagctgaaggtcaaggtcgag
gagcgcggccatatcaacgacgacctgcagaacctgatcgcgtcctcggagatcgccaca
gtgttcgtggaccgcggcatgcacgtcaagcgctataccccgcacgcgggcaacctgttc
aacctgattccctcggacctggggcgttcgctcttcgacatcacgagccggctggaatac
cccgaactcgaggaagacacggccgcggccttcaacgagttgcgcaccatcgagcgccat
gtgccgagcaccgacggccggcactttctcgcgcgcatccttccgtaccgcacggccgag
gacaagatcgagggcgcgatcctcaacttcttcgacatttccgagctgcgctttgcccag
gacaaggtgcgtgccggcgaggagcgcctgcgactggtggcggcaaccacgcgcgacttc
gcgatcatcaccaccgacgaggccgggctcatcaccacctggaacgccggcgcgcagcgc
atcttcggctacacggaagaagagatgctgcgccgcccgatcgcggtcatcttcaccgcc
gaagaccaggcgcacggcgtaccgcagcaggagatgcgccgcgcgaccgaaacgggccgc
gccgcggacgagcgctggcatgagcgcaaggacggcagccgcttcttctgcagcggcgtc
accagctcgctggaccccgcgagcggcggcggctttgccaagatcgcgcgggacatgacc
ggcacgaagcagcaggagctggcgcaggagcaccggctgttcaaggagaagcaggccaac
ctcagcgcgcagatggccaacgagctgaaggacaagttcctggccgtgatgtcgcatgag
ctcaagcagccgctgaacctcatccagatgaatgccgagctgctgatgcacctgccggcg
gccgcgcagattccggccgtgcagcgcgtgggcgaaaccatcaagcgcgccgtggcgagc
cagacgcggatcatcaacgacctgctggacctgtcgcgcatccgcacgggcaagctgcgg
ctgtcgcgtgtgacggtcgacctgggcgagctggtgcagtcggtggcccaggccgccgtg
gccgatgcgccgaagaagaagctgctgctggaaacccattgcgacgaggcggtgcattgc
cacggcgaccgggtgcgcgtcgagcagatcgcctggaacctgctgagcaacgccgtcaag
ttcacgcccgatggcggacgcatcagcgtgcgcgtggaaaccgagggcgacttcgccagg
ctcaccgtggccgacaccggctgcggcatcgccgcggagttcttgccgcacgtgttcggc
atgttcaaccaggccgacggcgacacggcgctgcccaacggcgggctggggatcggcctc
gcgctcgtgcaggaactcgcgctggcgcacggcggccgcgcggaggtgaagtcggcgggg
ccgggggagggcgcggagttcaccgtgtggctgccgggcagcggcgcgaccgacaggccg
gccaagaatgtgccgcacgccgaagtgagcttcggcggctggcgaatcctcgcggtggac
gactatgtcgatgcgctggcgccctttgccgaggtgctgcgcctggaaggggccgtcgtg
gacgtcgccgacagcgcgcgcaagggcctggaactgctcgacgccaacacctacgacctg
ctggtgtccgacctcggcatgcccgagatggacggctaccagttcatcgcggaagtgcgc
aagcgcccggccacgcgcgcgctgcacgcgattgccatgtccggcttcgggcggcgggcc
gacgcgcgccgcgcgctggaagccggcttcaatgcgcacctgcccaagcccgcctccatc
gaggaactgaaggccgccatcgccaggctctga

DBGET integrated database retrieval system