KEGG   Variovorax paradoxus EPS: Varpa_0974Help
Entry
Varpa_0974        CDS       T01392                                 

Definition
UDP-N-acetylmuramyL-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Varpa_0974
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Varpa_0974
Enzymes [BR:vpe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Varpa_0974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1086565..1088118
Genome map
AA seq 517 aa AA seqDB search
MLTLTSPQMAALWLKERVQGALHADSRPVGAGDGFIAWPGAATDGRKHVAAALAQGAAAC
LVEHEGVDAFGFGEDDRIASYPGLKAATGPIASAFYDNPSALLDVLAVTGTNGKTSTAWW
LAESLSTLRAAGGVRAMRPDGTTERSAPSPCAVMGTLGIGVPPDLTYTGLTTPDPVMMQG
ELRALVERGFGACAIEASSIGIAERRLDGAQIAVAVFTNFTQDHLDYHGSMDAYWEAKAE
LFRWPGLRAAVINIDDMHGASLCANLVDAGIGALDVWTVSAGGKPARLVARDIGYDAQGL
QFSVTEQGSVSVERLSTGLIGQYNVANLLGVLGTLRALGLSLSRAVAACANLTSVPGRME
RVSVGGNAPLAVVDYAHTPDALDKALAGLRPLAQQRGGALWCLFGCGGDRDPIKRPMMAA
VAERQADHVIVTSDNPRSEKPDAIISQVLRGFSRSDAAQVQPDRAAAIADAIAQAAPQDV
VLIAGKGHEAWQEIAGQRLPFSDKTHALDALTKRGAA
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctgacactcacctccccccaaatggccgcgctctggctcaaggagcgcgtgcagggt
gcgctgcatgccgacagccgtccggtgggcgcgggcgacggcttcatcgcctggcccggc
gccgcgaccgacgggcgcaagcacgtggccgccgcgctggcgcagggcgccgcggcctgc
ctggtcgagcacgaaggcgtcgatgccttcggcttcggtgaggatgaccgcatcgcgagc
taccccgggctcaaggccgcgaccggcccgatcgcctcggctttttacgacaacccctcg
gcgctgctcgacgtgctggcagtgaccggcaccaacggcaagacctccaccgcgtggtgg
ctggccgaatcgctttcgacgctgcgcgcggccggcggcgttcgcgcgatgcggcccgac
gggaccacggagcgcagcgcgccgtcgccctgcgccgtgatgggcacgctgggcatcggc
gtgccacccgatctcacctacaccggcctcaccacgcccgaccccgtgatgatgcagggc
gaactgcgcgcgctggtcgagcgcggcttcggcgcctgcgccatcgaagcatcgtcgatc
ggcatcgccgagcgacggctcgatggcgcgcagatcgcggtcgcggtgttcaccaatttc
acgcaggaccacctcgactaccacggcagcatggatgcctactgggaagccaaggccgag
ctcttccgctggccgggcctgcgcgccgcggtgatcaacatcgacgacatgcacggcgcg
agcctgtgcgcgaacttggtcgatgccggcatcggcgcgctcgatgtctggacggtgtcg
gccggcggcaagccggcgcgcctcgtggcacgcgacatcggctacgacgcgcagggcctg
cagttttcggtgaccgagcaggggagcgtgtcggtcgagcgtctttccaccggtctcatc
ggccagtacaacgtcgcgaacctgctcggcgtgctcggcacgctgcgcgcgctgggcctg
tcgctctcgcgggctgttgccgcgtgcgccaacctcaccagcgtgcccggccgcatggaa
cgcgtgagcgtcggtggcaatgcgcctcttgcggtggtcgactacgcccacacgcccgat
gcactcgacaaggcactcgcaggcctgcgcccgctcgcgcagcagcgcggcggtgcgctc
tggtgcctgttcggctgcggtggcgaccgcgacccgatcaagcgcccgatgatggcggcc
gtcgccgaacgccaggccgaccacgtcatcgtgaccagcgacaacccgcgcagcgaaaag
cccgacgcgatcatcagccaggtgctgcgcggcttctctcgctccgacgccgcccaggtg
cagcccgaccgcgccgccgccatcgccgacgcgatcgcacaggccgcgccgcaggacgtg
gtgctgatcgccggcaagggccacgaggcctggcaggagattgcgggccagcgcctgccg
ttctccgacaagacccacgcgctggatgcgctgacgaagcgaggtgcggcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system