KEGG   Variovorax paradoxus EPS: Varpa_1046Help
Entry
Varpa_1046        CDS       T01392                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00010  Glycolysis / Gluconeogenesis
vpe00052  Galactose metabolism
vpe00500  Starch and sucrose metabolism
vpe00520  Amino sugar and nucleotide sugar metabolism
vpe00521  Streptomycin biosynthesis
vpe01100  Metabolic pathways
vpe01110  Biosynthesis of secondary metabolites
vpe01120  Microbial metabolism in diverse environments
vpe01130  Biosynthesis of antibiotics
vpe01200  Carbon metabolism
Module
vpe_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Varpa_1046
   00052 Galactose metabolism
    Varpa_1046
   00500 Starch and sucrose metabolism
    Varpa_1046
   00520 Amino sugar and nucleotide sugar metabolism
    Varpa_1046
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Varpa_1046
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Varpa_1046
Enzymes [BR:vpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Varpa_1046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ADU35264
JGI: Varpa_1046
UniProt: E6UVN1
Position
1166347..1167273
Genome map
AA seq 308 aa AA seqDB search
MRACVDIGGTKVAVSLSPSADAPLIGRRSEPTAKTGDNDAVAVQIMRMIDEVCAEQGVDP
ATIDRVGVSSTGPFELHDGMVELATPNICGGIAGPARGLPNQWMTAIIEAPLAKRFGQVR
VENDAVAGLEAERHWGALKGFDHCAYATWSTGVGVGLCVDGRALRGKNGNAGHAGHSFVV
DDASGALCGCGNLGDVEALVAGNSISRRFGQPAPDLFSAASAGEPHALEIVDALCRVMGL
MLYNMVITLDLQRISLGGSVFWHHRDFLLPRLQAQIDGKLMPLTRGVLLVPAGLGEKVGD
YAALALLD
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagagcctgcgtagacatcggcggcaccaaggtggccgtgagcctttccccctccgcc
gacgcgccgttgatcggccgtcgcagcgagccgaccgccaagaccggcgacaacgacgcc
gtggcggtgcagatcatgcggatgatcgacgaggtctgcgccgagcagggggtcgatccg
gccaccatcgaccgcgtgggcgtgtcgtcgaccggccccttcgagctgcacgacggcatg
gtcgagctcgcaacgccgaacatctgcggcggcatcgccggtccggcgcgcggtctgccc
aaccagtggatgaccgccatcatcgaagcgccgctggccaagcgcttcggacaggtgcgt
gtcgagaacgatgcggtggctggtttggaggccgagcgccactggggcgcgctcaagggg
ttcgatcactgtgcgtatgccacctggagcacgggcgttggcgtcggcctctgcgtcgac
gggcgtgccctccgcggcaagaacggcaatgcaggccatgcggggcacagcttcgtggtg
gacgacgcaagcggcgcgctgtgcggctgcggcaacctgggcgatgtcgaggcgctggtc
gccggcaactcgatttctcgccgattcggccagcccgcccccgacctgttctcggcggcc
tcggccggcgaaccgcatgcgctggaaatcgtggatgcgctgtgccgcgtcatgggcctc
atgctctacaacatggtcatcacgctggacctgcagcgcatcagcctgggcggcagcgtg
ttctggcaccaccgcgatttcctgctgccccggctgcaggcgcagatcgacggcaagctg
atgccgctcacccgcggcgtgctgctggtgcccgcggggctcggcgaaaaggtcggcgac
tacgcggcgctggctttgctggactga

DBGET integrated database retrieval system