KEGG   Variovorax paradoxus EPS: Varpa_1046Help
Entry
Varpa_1046        CDS       T01392                                 

Definition
rok family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Varpa_1046
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Varpa_1046
   00052 Galactose metabolism
    Varpa_1046
   00500 Starch and sucrose metabolism
    Varpa_1046
   00520 Amino sugar and nucleotide sugar metabolism
    Varpa_1046
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Varpa_1046
   00524 Butirosin and neomycin biosynthesis
    Varpa_1046
Enzymes [BR:vpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Varpa_1046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1166347..1167273
Genome map
AA seq 308 aa AA seqDB search
MRACVDIGGTKVAVSLSPSADAPLIGRRSEPTAKTGDNDAVAVQIMRMIDEVCAEQGVDP
ATIDRVGVSSTGPFELHDGMVELATPNICGGIAGPARGLPNQWMTAIIEAPLAKRFGQVR
VENDAVAGLEAERHWGALKGFDHCAYATWSTGVGVGLCVDGRALRGKNGNAGHAGHSFVV
DDASGALCGCGNLGDVEALVAGNSISRRFGQPAPDLFSAASAGEPHALEIVDALCRVMGL
MLYNMVITLDLQRISLGGSVFWHHRDFLLPRLQAQIDGKLMPLTRGVLLVPAGLGEKVGD
YAALALLD
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagagcctgcgtagacatcggcggcaccaaggtggccgtgagcctttccccctccgcc
gacgcgccgttgatcggccgtcgcagcgagccgaccgccaagaccggcgacaacgacgcc
gtggcggtgcagatcatgcggatgatcgacgaggtctgcgccgagcagggggtcgatccg
gccaccatcgaccgcgtgggcgtgtcgtcgaccggccccttcgagctgcacgacggcatg
gtcgagctcgcaacgccgaacatctgcggcggcatcgccggtccggcgcgcggtctgccc
aaccagtggatgaccgccatcatcgaagcgccgctggccaagcgcttcggacaggtgcgt
gtcgagaacgatgcggtggctggtttggaggccgagcgccactggggcgcgctcaagggg
ttcgatcactgtgcgtatgccacctggagcacgggcgttggcgtcggcctctgcgtcgac
gggcgtgccctccgcggcaagaacggcaatgcaggccatgcggggcacagcttcgtggtg
gacgacgcaagcggcgcgctgtgcggctgcggcaacctgggcgatgtcgaggcgctggtc
gccggcaactcgatttctcgccgattcggccagcccgcccccgacctgttctcggcggcc
tcggccggcgaaccgcatgcgctggaaatcgtggatgcgctgtgccgcgtcatgggcctc
atgctctacaacatggtcatcacgctggacctgcagcgcatcagcctgggcggcagcgtg
ttctggcaccaccgcgatttcctgctgccccggctgcaggcgcagatcgacggcaagctg
atgccgctcacccgcggcgtgctgctggtgcccgcggggctcggcgaaaaggtcggcgac
tacgcggcgctggctttgctggactga

DBGET integrated database retrieval system