KEGG   Variovorax paradoxus EPS: Varpa_1249Help
Entry
Varpa_1249        CDS       T01392                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:vpe00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:vpe00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1404683..1405972
Genome map
AA seq 429 aa AA seqDB search
MDKLLIRGGRQLRGEVLISGAKNAALPELCAALLTDQPVTLHNVPRLQDVSTMLKLVRNM
GVVAERDDNGTVQLNAGDLTNPEAPYELVKTMRASVLALGPLLARFGHAKVSLPGGCAIG
SRPVDQHIKGLQAMGAEIVVEHGYMIASLPAGRTRLKGARILTDMVTVTGTENFLMAAAL
AEGETLLENAAQEPEIVDLAEMLIRMGAKIEGHGTSHIRIQGVEKLHGCEHAVVADRIEA
GTFLCAVAATGGEVFLRHARPDHMDAVIDKLRDAGCAVAPEEGGVRISSKAPASEHLKAQ
SFSTTEYPGFPTDMQAQFMALNVIARGASMVTETIFENRFMHVNEMVRLGATIHVEGKVA
MVEGVQQLSGATVMATDLRASASLVIAGLVAEGETLIDRIYHLDRGYDRMEAKLRGLGAD
IERVTGAAA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggacaaacttctgattcgcggcgggcgccagcttcgcggcgaggtactcatttccggc
gccaagaatgccgcgctacccgagctgtgcgcggcgctgctgaccgaccagcccgtgacg
ctgcacaacgtgccccgactgcaggacgtgtcgaccatgctcaagctggtgcgcaacatg
ggcgtcgtggccgagcgcgacgacaacggcaccgtgcaactgaacgctggcgatctcacc
aatcccgaagccccttacgagctggtcaagaccatgcgcgcctcggtgctggcgctcggc
ccgctgctcgcgcgcttcggacacgccaaggtgtcgctgcccggcggctgcgccatcggc
tcgcgccccgtcgaccagcacatcaagggcctgcaggcgatgggcgccgagatcgtggtc
gagcatggctacatgatcgccagcctgccggcaggccgcacccgcctgaagggcgcgcgc
atcctgaccgacatggtcaccgtcaccggcaccgagaacttcctcatggccgccgcgctg
gccgagggcgagacgctgctggaaaacgcagcgcaggagcccgagatcgtcgacttggcc
gagatgctgatccgcatgggcgccaagatcgaaggccatggcaccagccacatccgaatc
cagggcgtcgagaagctgcacggctgcgagcacgccgtcgtggccgaccgcatcgaggcc
ggcacgttcctctgcgccgtcgcggccacgggcggcgaggtgttcctgcgccacgcccgc
cccgaccacatggacgcggtgatcgacaagctgcgcgacgccggctgcgcggtcgcgccg
gaagagggcggtgtgcgcatcagctccaaggccccggccagcgagcacctgaaggcgcag
agcttcagcaccaccgaataccccggtttccccaccgacatgcaggcccagttcatggcg
ctgaacgtgattgcgcgcggtgcctcgatggtcaccgaaacgatcttcgagaaccgcttc
atgcacgtgaacgagatggtgcgcctgggcgcgaccatccacgtcgaaggcaaggtcgcg
atggtcgaaggtgtgcagcaactgtcgggcgccacggtgatggccaccgacctgcgcgcc
tccgccagcctcgtgatcgccggcctcgtggccgagggcgagacgctgatcgaccgcatc
tatcacctggatcgcgggtacgaccgcatggaggccaagctgcgcggcctcggtgccgac
atcgagcgcgtgaccggagccgccgcatga

DBGET integrated database retrieval system