KEGG   Variovorax paradoxus EPS: Varpa_1381Help
Entry
Varpa_1381        CDS       T01392                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Varpa_1381
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Varpa_1381
Enzymes [BR:vpe01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Varpa_1381
Lipid biosynthesis proteins [BR:vpe01004]
 Desaturase
  First
   Varpa_1381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1538663..1539877
Genome map
AA seq 404 aa AA seqDB search
MLLPDSAVLNAAIQWLGHGLWDLTWWQVVLYTLVTTHITIAAVTIFLHRTQTHRAMDLGP
IPSHFFRFWLWLGTGMVTKEWVAIHRKHHAKCETQEDPHSPQVKGIDEVFWRGAELYRKE
SKNKDTIDRYGHGTPDDWIERNLYSRYSWQGVGLMLVINLALFGTLGMAVWAVQMLWIPI
TAAGIINGIGHYWGYRNFEAPDASRNITPWGLIIGGEELHNNHHTYPTSAKFSVKKYEFD
IGWVYIQAMQAIGWAKVKKVPPKMQMGDIQPVANEKTLEAVIANRYEVMAGYAREMRRAT
SEELAQLKTKGADLSVLKAAKRWLHRDDDKVPASARTHIVQARAAHPVLDKMVTMREELR
QLWLNTSQSREQLAADLAAWCHRAEASGIAGLREFSTRLRSARA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgttgcttcctgactctgccgttctcaatgcggccatccaatggctcggacacggcttg
tgggacctcacttggtggcaagtcgtgctgtacacgctcgtcaccacgcacatcacgatt
gccgcggtcacgattttcctgcaccgcacgcaaacgcaccgggccatggatctgggcccg
atcccctcgcattttttccgcttctggctgtggctcggcaccggcatggtgaccaaggaa
tgggtcgccattcaccgcaagcaccacgccaagtgcgaaacccaggaagatccgcacagt
ccgcaggtcaagggcatcgacgaggtgttctggcgcggtgcagagctgtatcgcaaggaa
tcgaagaacaaggacacgatcgatcgttacggccacggcacgcccgatgactggatcgag
cgcaacctctattcgcgctacagctggcaaggtgtgggcctgatgctggtgatcaacctg
gcgctgttcggcacgctcggcatggccgtgtgggcagtccagatgctttggattccgatt
accgccgccggcatcatcaacggcatcggtcactactggggttaccgcaacttcgaggcg
cccgatgccagccgcaacatcacgccctggggcctgatcatcggtggcgaagagctgcac
aacaatcaccacacctacccgacgtcggccaagttctcggtcaagaaatacgagttcgac
atcggctgggtctacatccaggcgatgcaggccatcggctgggccaaggtcaagaaggtg
ccgccgaagatgcagatgggcgatatccagcccgtggccaacgagaagacgctcgaggct
gtcatagccaatcgctacgaagtcatggctggctatgcgcgcgaaatgcgccgtgctacc
agtgaagaactggctcagttgaagaccaagggtgccgacctgtcggtgctcaaggcagcc
aagcgctggctgcaccgtgacgacgacaaggtgcccgcatccgctcgcacgcatatcgtg
caggctcgcgcagcccatccggtgctcgacaagatggtgacgatgcgcgaagagttgcgc
cagctttggctgaacacctcgcagtcgcgcgagcaactggcggccgaccttgctgcttgg
tgccaccgtgcggaagcgagtggtattgctggtctgcgcgagttctccacgcgtctgcgt
tctgctcgcgcttga

DBGET integrated database retrieval system