KEGG   Variovorax paradoxus EPS: Varpa_1514Help
Entry
Varpa_1514        CDS       T01392                                 

Definition
(GenBank) uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00860  Porphyrin and chlorophyll metabolism
vpe01100  Metabolic pathways
vpe01110  Biosynthesis of secondary metabolites
vpe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Varpa_1514
Enzymes [BR:vpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Varpa_1514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ADU35725
JGI: Varpa_1514
UniProt: E6V2K4
Position
1683462..1684244
Genome map
AA seq 260 aa AA seqDB search
MTARPVIVTRPAREAVQWVDDLRAAGLDAVALPLIVIEPVHDAEPLRAAWRRIEDYAALM
FVSATAVEHFFQSRDADSSDEAMAGRRFWATGPGTTRALLRAGVPPEAIDAPPPEATRFD
SEALWERVQAQVSTGVRVLIVRGGDEAGQPAGRDWLAKEIDAASGQRDTVVAYRRLPPLF
DVGQRQLAIDGAQGRAIWLFSSSEAIANLQRAMPGTDWHAASAVATHARIGEAARAAGFG
ALRVCTPLRDALIASIESLA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgcggcccgtcatcgtcacgcggcccgcgcgcgaggccgtgcagtgggtcgac
gacctgcgcgccgccgggctcgatgcggtggcgctcccattgatcgtcatcgagccggtc
cacgatgccgagccgctgcgcgcggcctggcggcgcatcgaagactacgccgcgctgatg
ttcgtcagcgccacagcagtcgagcatttcttccagagcagggacgcggattcatccgac
gaagcgatggccggccgccgcttctgggccacggggcccggcacgacgcgtgccctgctg
cgcgccggcgtgccgcccgaagccatcgatgcaccgccgcccgaggccacgcgcttcgac
tccgaggcgctgtgggagcgtgtccaggcccaggtatcgaccggcgtgcgcgtgctcatc
gtgcgcggcggcgatgaagccgggcaacccgccggccgcgactggctcgccaaggagatc
gacgccgcgagcgggcagcgcgacacggtggtggcctatcgccgattgccgccgttgttc
gatgtcggacaacgtcaactcgccatcgatggtgcgcaaggccgcgctatctggctcttc
agcagctcggaagcgatcgccaatctccagcgcgcgatgcccggcaccgactggcacgcc
gcaagcgcggtcgccacgcacgctcgcatcggcgaagccgcgcgggccgcgggttttggt
gcgttgcgtgtctgcacacctctgcgggatgcgttgatcgcgtcgatagaatcgttggca
tga

DBGET integrated database retrieval system