KEGG   Variovorax paradoxus EPS: Varpa_1548Help
Entry
Varpa_1548        CDS       T01392                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
vpe  Variovorax paradoxus EPS
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Varpa_1548
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Varpa_1548
Enzymes [BR:vpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Varpa_1548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1717221..1718333
Genome map
AA seq 370 aa AA seqDB search
MTATTTSSIHAPLIIDVAGTELNDADRRRLANPLVGGVIHFTRNWQDRAQMTALNAEIKA
IRPDLLICVDHEGGRVQRFRTDGFTHLPSMRSLGELWMRDAMRATQAATAAGQVLAGELR
ACGIDFSFAPVLDLDYGGSSVIGDRSFHRDPRVVSLLAKSVMHGMLQMGMRNCGKHFPGH
GFVNADSHVEIPVDRRSLKAILADDAKPYDWLAGTLAAVMPAHVIYPKVDARPAGFSSKW
LQDVLRIRLGFDGAIFSDDLSMEAGRYIDGELLSFTDAALAALDAGCDLAMVCNQSIIGA
GLPLDALLEGFGAMAAAGRWKGAAASEARRRALLPFPDALEWPALVASKNYTSALRLLAA
ELVLLLPVRS
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgacaacgaccagtagcatccacgcgccgctcatcatcgatgtggcgggcacc
gaactcaacgacgccgaccgccggcgccttgcaaacccgctggtcggcggcgtgattcat
ttcacccgcaactggcaggaccgcgcgcagatgaccgcgctcaatgccgagatcaaggcg
attcgccccgacctgctgatctgcgtcgaccacgagggcgggcgcgtgcagcgctttcgc
acggacgggttcacgcacctgccatcgatgcgttcgctcggtgagttgtggatgcgcgac
gccatgcgcgccacgcaggccgcgacggcggcggggcaggtgctcgccggtgaactgcgg
gcctgcggcatcgacttcagctttgcaccggtgctcgacctggattacggcggcagcagc
gtgatcggcgaccgcagcttccaccgcgacccgcgcgtggtgtcgctgttggccaagagc
gtgatgcacggcatgctgcagatgggcatgcgcaattgcgggaagcactttccggggcat
gggtttgtgaatgcggactcgcatgtcgagattccggtcgacaggcgcagcctcaaggca
atcctggccgatgacgccaagccctacgactggctcgccggcacgcttgccgccgtgatg
ccggcgcacgtcatctatcccaaggtcgatgcgcggccggcgggcttttcttcgaagtgg
ctgcaggacgtgctgcgcatccggctcggcttcgatggcgcgatcttcagtgacgacctg
agcatggaggcgggacggtacatcgatggcgagctgttgagcttcaccgatgcggcgttg
gcggcgctggatgcgggatgcgacctggccatggtctgcaatcaaagcatcatcggtgcg
ggactgccgttggatgcattgctcgaggggttcggcgcgatggcggccgcaggtcgttgg
aagggtgcagcagcgagcgaagctcggcggcgcgcgcttctgcctttccccgatgccctc
gaatggccagcgcttgtggcttcgaagaactacaccagcgccctgcgactgttggccgcc
gagctggtgcttctcttgccggtcaggtcctga

DBGET integrated database retrieval system