KEGG   Variovorax paradoxus EPS: Varpa_1559Help
Entry
Varpa_1559        CDS       T01392                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Varpa_1559
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Varpa_1559
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Varpa_1559
Enzymes [BR:vpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Varpa_1559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1730101..1730946)
Genome map
AA seq 281 aa AA seqDB search
MSRIAATFKTLEAQGRKALIPYVTAGFPFADITPELMHGMVEAGADVIELGVPFSDPMAD
GPVIQKAGEAALALGVGMKQVLAIVAAFRQKDTTTPVVLMGYANPVERYDLVHGKQAFIR
DASAAGVDGLLVVDYPPEECEAFAADLKAANIDLIFLLAPTSTDERMAQVARIASGYVYY
VSLKGVTGAGHLDTEAVGQMIPRIRQHVSIPVGVGFGIRDARTAQAVGSAADAVVIGTKI
IQLIDGQPREKVVPAVREFLAGIREALDALPAATPKNAAGR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcattgccgccaccttcaagaccctcgaggcgcagggccgcaaggcgctgatt
ccgtatgtcaccgccggcttccccttcgccgacatcacccccgagctaatgcacggcatg
gtcgaggcaggcgccgacgtgatcgagctgggcgtgcctttttccgacccgatggccgac
ggccctgtgatccagaaggccggcgaagccgcgctggccctgggcgtcggcatgaagcag
gtgctcgccatcgtggccgcgtttcgccagaaggacacgaccacgccggtggtgttgatg
ggctatgcgaacccggtcgagcgctatgacctcgtgcacggcaaacaggccttcatccgc
gacgcatcggccgccggggtcgacggcctgctggtcgtcgactacccgcccgaggaatgc
gaggccttcgctgccgacctgaaggcggcgaacatcgacctgatcttcctgctggcgccc
acgagcaccgacgagcgcatggcgcaggtcgcgcgcatcgcgagcggctacgtctactac
gtgtcgctcaagggcgtgaccggcgccggccacctggacaccgaggcggtcggccagatg
atcccgcgcatccgtcagcatgtgagcatcccggtcggcgtgggcttcggcatccgcgac
gcacgcaccgcgcaggcggtcggttcggcggcggacgccgtggtgatcggcaccaagatc
atccagctgatcgacgggcaaccgcgcgagaaggtggtgcccgcggtgcgcgaattcctc
gccggcatccgcgaggcgctggacgccctgccggcggctacccccaagaatgcggctggc
cgataa

DBGET integrated database retrieval system