KEGG   Variovorax paradoxus EPS: Varpa_1560Help
Entry
Varpa_1560        CDS       T01392                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Varpa_1560
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Varpa_1560
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Varpa_1560
Enzymes [BR:vpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Varpa_1560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1730946..1732232)
Genome map
AA seq 428 aa AA seqDB search
MQSNFQDYQQPDATGHFGNYGGTFASETLTHAINELRDAYAKFKDDPAFLAEFHYELKHF
VGRPSPIYHAARTSREMGGAQIYLKREDLNHTGAHKINNVIGQAMLARRMGKPRVIAETG
AGQHGVATATICARYGLECVVYMGSQDVKRQSPNVYRMNLLGATVVPVESGSKTLKDALN
EAMRDWVTNVENTFYIIGTVAGPHPYPTMVRDFQSVIGTECIEQMPAMLAADGITGEAEG
KQPDVVVACVGGGSNAIGIFHPYIPFAGTRLIGVEAAGEGLDSGKHAASILRGSPGVLHG
NRTYLLQNEDGQITETHSISAGLDYPGVGPEHAHLADIGRAEYVGITDVEALEAFHYLCR
TEGIIPALESSHAVAYALKLAKTMRPDQSILVNLSGRGDKDIGTVADLSGVDFYDRPSMR
GLSVKGGK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcaatttccaggattaccagcaacccgacgccaccggccacttcggcaactac
ggcggcaccttcgcaagcgaaacgctcacccacgcgatcaacgagctgcgcgacgcgtac
gccaagttcaaggacgatccggcgttcctcgccgaattccactacgagctgaagcacttc
gtcggccggccctcgccgatctatcacgctgcgcgcaccagccgcgaaatgggcggcgcg
cagatctacctcaagcgtgaagacctcaaccacactggcgcgcacaagatcaacaacgtg
atcggccaggcgatgctcgcgcggcgcatgggcaagcctcgcgtgatcgccgagaccggg
gccggccagcacggcgtggccaccgccacgatctgcgcgcgctacggcctggaatgcgtg
gtctacatgggcagccaggacgtgaagcgccagagccccaacgtctaccgcatgaacctg
ctcggcgcgaccgtggtgccggtcgaatcgggcagcaagacgctgaaggacgcgctcaac
gaggcgatgcgcgactgggtcaccaatgtggaaaacaccttctacatcatcggcaccgtg
gccggcccgcacccctacccgacgatggtgcgcgacttccagagcgtgatcggcaccgag
tgcatcgagcaaatgcccgccatgctggcggccgacggcatcaccggcgaagccgagggc
aagcagcccgacgtggtggtcgcctgcgtgggcggcggcagcaatgcgatcggcatcttc
catccctacattccgttcgccggcacccggctcatcggcgtggaagcggcgggcgaaggc
ctggacagcggcaagcacgcagcctccatcctgcgcggcagcccaggcgtgctgcacggc
aaccgcacctacctgctgcagaacgaggacggccagatcaccgagacgcacagcatcagc
gccggcctcgactaccccggcgtgggcccggagcacgcgcacctggccgacatcggccgt
gccgagtacgtcggcatcaccgacgtcgaggcgctcgaagccttccactacctgtgtcga
acggagggcatcattcccgcgctcgaatccagccacgccgtggcctatgcgctgaagctc
gcgaaaaccatgcgccccgaccagtcgatcctggtgaacctctcgggccgcggcgacaag
gacatcggcaccgtcgccgacctgtcgggcgtcgatttctacgaccgcccctcgatgcgc
ggcctgagcgtgaagggaggcaagtga

DBGET integrated database retrieval system