KEGG   Variovorax paradoxus EPS: Varpa_1573Help
Entry
Varpa_1573        CDS       T01392                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00020  Citrate cycle (TCA cycle)
vpe00190  Oxidative phosphorylation
vpe00650  Butanoate metabolism
vpe01100  Metabolic pathways
vpe01110  Biosynthesis of secondary metabolites
vpe01120  Microbial metabolism in diverse environments
vpe01130  Biosynthesis of antibiotics
vpe01200  Carbon metabolism
Module
vpe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vpe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vpe_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Varpa_1573
   00650 Butanoate metabolism
    Varpa_1573
  Energy metabolism
   00190 Oxidative phosphorylation
    Varpa_1573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ADU35784
JGI: Varpa_1573
UniProt: E6V3K4
Position
complement(1746645..1747010)
Genome map
AA seq 121 aa AA seqDB search
MSVNYGSKRIVVGAHYGLRDWLSQRITGGLMALFTVILLAQMIFTRGPIGYDLWAGIFAA
QWMKVLTFSVIVSLLYHVWVGMRDVWMDYVQPVGIRLVLQIFTIVWLVGCAGWAIQVLWK
I
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaattacggctccaagcgcatcgtcgtcggtgctcattacggtttgcgcgac
tggctcagccagcgcatcacgggcggcctgatggcgctcttcacggtcatcctgctcgcg
cagatgatcttcacgcgcggccccatcggctacgacctctgggccggcatcttcgccgcg
cagtggatgaaggtgctgaccttctccgtgatcgtctccctgctatatcacgtgtgggtc
ggcatgcgcgacgtgtggatggactatgtccagcccgtcggcatccgtcttgtgctgcaa
attttcaccatcgtctggcttgtcggttgtgcgggttgggccattcaagtgctttggaag
atctga

DBGET integrated database retrieval system