KEGG   Variovorax paradoxus EPS: Varpa_2049Help
Entry
Varpa_2049        CDS       T01392                                 

Definition
protein-L-isoaspartate o-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
vpe  Variovorax paradoxus EPS
Brite
Enzymes [BR:vpe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Varpa_2049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2237280..2238053
Genome map
AA seq 257 aa AA seqDB search
MATQRPSFPVRLTPTASAATRGRMPAVPAKPMVPSTPSMASDAVRARMVQKLAAQGISDP
RVLRAMSAVERHRFVDSALVNQAYEDTSLPIGLGQTISKPSVVARMIELLLAAPALAGKP
QDRLGRVLEIGTGCGYQAAVLNHVATEVYSIERLRGLHERARTNLRHFRLATVHLMLGDG
MIGYAKGAPYAGIIAAAGGEAVPEAWISQLAVGGRIVAPTHSDKGGQALVVIDKTARGLE
RLILEAVHFVPLKSGIA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggccacgcaacggccgagtttcccggttcgactgacccccaccgcttcggctgccacg
cgcgggcgcatgcccgccgtgccggccaagccgatggtgccgtccacgccttcgatggcc
tccgacgcggtgcgcgcgcgcatggtgcagaagctcgcggcgcagggcatttccgacccg
cgcgtgttgcgcgcaatgagcgccgtcgagcggcatcgcttcgtcgacagcgcgctggtc
aaccaggcgtacgaagacaccagcttgccgatcggcctggggcagacgatctccaagccg
agcgtggtggcccgaatgatcgagctcctgctcgctgcgcccgcgttggccggcaagccg
caggaccggcttggccgcgtgctcgagatcggcaccggctgcggctaccaggccgctgtg
ctgaaccacgtggcgaccgaggtctacagcatcgagcgcctgcgcggcctgcacgagcgt
gcgcgcacgaacctgcggcacttccggctggccacggtgcacctgatgctgggcgacgga
atgatcggctatgccaagggcgcgccctatgcgggcatcatcgcggcggcgggcggcgaa
gccgttccggaagcctggatttcacaactcgcggtcggcgggcgcatcgttgcgccgacc
cattcggacaagggcggacaagccctcgtcgtcatcgacaaaaccgcccgcggactggag
cgtctcattcttgaggcggttcactttgtccccctaaaatcgggcatcgcttga

DBGET integrated database retrieval system