KEGG   Variovorax paradoxus EPS: Varpa_2957Help
Entry
Varpa_2957        CDS       T01392                                 

Definition
cheb methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:vpe02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:vpe02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3183313..3183921)
Genome map
AA seq 202 aa AA seqDB search
MTTTLPRPYTRKRVDMVVLGASAGGIDALMMLLHDLPAGWRLPMTVVLHLPENHDSHLAE
IFAQRLPIPVHEAADKMPIAVGTLYFAPPGYHLSIERERCFSLSCEAPVLFSRPSIDVLM
ASAADAYGPALAGFLLTGANDDGAEGLYRIHLAGGLTAVQDPKEALISIMPNAALARHAP
NHVLPLRELRALLLQLEAAHAH
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgacgctgcctcgtccctacacccgcaagcgcgtggacatggtcgtgctcggc
gcttcggccggcggtatcgatgcgctcatgatgctcttgcacgacctgcccgccggttgg
cgcctgccgatgacggtcgtgctgcacctgcccgagaaccacgacagccatctcgcagag
atcttcgcgcagcgcctgcccattcccgtgcacgaggccgccgacaagatgccgattgcc
gtcggcacgctttatttcgcgccgcccggctaccacctgtcgatcgagcgggagcgttgc
ttctcgctcagttgcgaggcgccggtgctgttctcgcggccgtccatcgacgtgctgatg
gcctcggccgccgacgcctacggccccgcactggccggttttctcttgaccggcgccaac
gacgatggcgccgaaggcctgtatcgcattcacctggccggcggactcaccgccgtgcag
gaccccaaagaagccctgatttccatcatgcccaacgccgcccttgcgcgacacgccccc
aaccacgtattgccgctgcgcgagcttcgcgccctgctcctgcaactggaggccgcccat
gcccattga

DBGET integrated database retrieval system