KEGG   Variovorax paradoxus EPS: Varpa_3003Help
Entry
Varpa_3003        CDS       T01392                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Varpa_3003
Enzymes [BR:vpe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Varpa_3003
Exosome [BR:vpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Varpa_3003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3232408..3234297
Genome map
AA seq 629 aa AA seqDB search
MPLNHSLQGERDAYLFREGTHSRLYDLLGCHPQEEGGAHFAVWAPNAESVSVVGDWNYWS
GDADPLQPSPDGTGIWRGHVPQAAIGQAYKYRIRSRHNGYTVDKADPVAFSAEPPPATAS
RICELSYKWGDAEWMANRGPFNALDAPQSVYEVHLGSWRRKDGQFLGYREIAHQLADYVT
KMGFTHVELMPVTEHPFYGSWGYQTTGYFAPTARFGSPQDFMYLVDHLHQQGIGVLLDWV
PSHFPTDEHGLGYFDGTHLYEHADPRQGFHPEWSSSIFNYGRPEVRSFLVSSGLFWLDLY
HLDGLRVDAVASMLYLDYARKHGEWIPNRHGGRENLEAIDFLQTLNRAVYREHPDTVTVA
EESTAWPRVSRPTDMDGLGFGEKWNMGWMHDTLAYMKEDPVNRKYHHHKLTFSLVYAFHE
NFVLPLSHDEVVHGKGSLINKMPGDPWQQFANLRALYGFMWAHPGKKLLFMGGEFGQRRE
WTHDGELEWWVCEQEGHGGVQRLVAQLNRVYRAAPALHQVDFASSGFEWVTANDEAQSVF
AFLRKAADGSPPLLVVSNMTPVPRTNYLLGVPLGGHWREVINTDATEFGGAGWGNFGGVE
AAPVRSHGHRQSVCITLPPLSTLILEHRP
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
gtgccgttgaaccattcactccagggcgagcgagacgcttatctttttcgggaagggacc
cactcccgcctgtatgacttgctgggttgtcatccgcaggaagagggcggagcccacttc
gcggtgtgggcgccgaacgccgaatctgtttccgtagtgggcgactggaactactggtcc
ggcgatgccgatccgctgcagcccagccccgacggcacgggcatctggcgcgggcatgtg
ccgcaagccgccatcgggcaggcctacaagtaccgcatccgttcgcgccataacggctac
acggtcgacaaggccgacccggtcgccttcagcgccgagccgccgcccgccaccgcgtcg
cgcatctgcgagctttcgtacaaatggggcgatgcggaatggatggccaaccgcgggccc
ttcaatgcgctcgatgcgccgcagtcggtgtacgaagtgcacctgggctcatggcgccgc
aaggacggccagttcctcggctaccgcgagatcgcgcaccagctggccgactacgtgacg
aagatgggcttcacgcatgtggagctcatgccggtgaccgagcatccgttctacggctcg
tggggctaccagaccaccggctacttcgcgcccaccgcgcgcttcggttcgccgcaggac
ttcatgtacctcgtggaccacctgcaccagcagggcatcggcgtgctgctggactgggtg
ccctcgcactttccgaccgacgagcacggcctgggctacttcgacggcacgcacctgtac
gagcatgccgatccgcgccagggcttccaccccgagtggagctcgagcatcttcaattac
ggccggccggaggtgcgcagcttcctggtgtcttcgggcctgttctggctggacctgtac
cacctcgatggcctgcgggtggacgcggtcgcctccatgctctacctcgactacgcgcgc
aagcacggcgaatggattcccaaccgccacggcgggcgcgagaacctggaagccatcgac
ttcctgcagacgctgaaccgcgccgtctaccgcgagcaccccgacaccgtcaccgtggcc
gaggaatcgaccgcctggccgcgcgtctcgcgccccaccgacatggacggcctcggcttc
ggcgagaaatggaacatgggctggatgcacgacacgctggcctacatgaaagaggaccct
gtcaaccgcaagtaccaccaccacaagctgaccttctcgctggtgtatgccttccacgag
aacttcgtcctgccgctctcgcacgacgaggtggtgcacggcaagggttcgctcatcaac
aagatgcccggcgacccctggcagcagttcgccaacctgcgggcgctctacggcttcatg
tgggcgcacccgggcaagaagctgctcttcatgggcggcgagttcggccagcgccgcgag
tggacgcacgacggcgagctcgaatggtgggtctgcgagcaggaagggcacggcggcgtg
cagcgcctggtggcacagctcaaccgcgtgtaccgcgcggcgcccgcgctgcaccaggtc
gacttcgcttcgtcgggcttcgagtgggtcacggccaacgacgaggcccagagcgtgttc
gcgttcctgcgcaaggccgccgacggcagcccaccgctgctcgtggtgagcaacatgacc
ccggtgccgcgcaccaactacctgctcggcgtgccgctgggcggccactggcgcgaggtg
atcaacaccgacgccaccgagttcggcggcgcgggctggggcaatttcgggggcgtcgag
gcggcgcccgtgcgttcccacggacacaggcaatcggtgtgcatcaccttgccgcccttg
tccacgctgatcctggagcaccggccctga

DBGET integrated database retrieval system