KEGG   Variovorax paradoxus EPS: Varpa_3009Help
Entry
Varpa_3009        CDS       T01392                                 

Definition
malto-oligosyltrehalose synthase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
K06044  
(1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase [EC:5.4.99.15]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Varpa_3009
Enzymes [BR:vpe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Varpa_3009
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.15  (1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase
     Varpa_3009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3244724..3249865
Genome map
AA seq 1713 aa AA seqDB search
MVDEANHGPVGGDLGRLCEHFGIATGYFDAFGVRCEVSARSLVALLGEFGVKLDNAGDAG
RALDVARRARWAEALPPVQVVQAGNPAWSVTLRVPASMGRLRWRIGDEHGREVEGEVDAD
TLHENGRSEIDGTLLCERVLHVPLALEAGYHRLRIEGLRGETLLLATPGHCYRPPAVREG
GRVWGTAVQLYSLRSPRNWGIGDFGDLEDLAVRMSAQGADVIGLNPLHALFASTPSNASP
YSPSSRQQLNVLYIDVEAVDGFADCAPARDRVHSPDFQARLAALRAAPLVDYAGVAQAKF
EVLALLFGDFCARHLPAEGAPSEEGRAFLAFVAERGEALRQHALFETLQAHFLETEGGAW
DWHDWPAAWRDADSAEVTAFAVAHAQRVQFHQYLQWLATRQLARVAARCEALGMGVGLYV
DLAVSVDRAGSDTWGAQRVFADGASVGAPPDEFNPAGQGWGLPPLRPDRLREDGYRFFIE
TLRAGMRGAGALRIDHVMGLMRLFWIPQGRSAREGAYVYYPLAEMLAIVAIESHRHRCMV
VGEDLGTVEDAVREALARADVLSYRLLYFEKRHDGGFKPPEAYPAAALVAISTHDLATFA
GWWTAADLRERLALDLFPDPAIFDKQLMDRARERIELTQALQHAGLLSREEAAEAAGLAM
PSPRLVEAAHAFLAATPSALLMVQLEDVAGVVAQANMPGTVDQHPNWRRKLPEPVAVLAN
GDGMRGLGEALRAARPRRIDAGEGESPGLQTRVPRATYRLQFHKDFGFDDAIRVLPYLAK
LGVSHVYCSPIQRARPGSMHGYDVVAHAEVNPELGGEEGFARFVAALKANGLGQLLDMVP
NHMGVFGADNAWWMDVLENGPASLFAQHFDIDWHPLNVELTGKVLLPVLGVHYGEALDNG
ELVLRFEDATGSFAVTYYDHRFPLAPESYPVVLERALSRLGDAAAAARLASLSTAFGHLP
PRDTSDPKAQAERVRDKELLKARLARLAERHPAVAEALVASVAELNLASPEARDALHRLI
ELQAFRLAHWRVAADEINYRRFFDINDLAAVRMERDEVFEATQSFALDLAASGMVDGLRI
DHPDGLYDPADYFRKLQEGYARRAGLVLPTHDAEGRPARPLYVVAEKIAGAHEEVPESWH
VHGTTGYRFANVANGVLVDTAAEAAVLHAWQRFTGETEDFAAMSRAGRREVMRNALSSEL
NVLSTELLRIARADRSTRDYTLNALRRALAEVGACMPVYRTYIVEHPSAQDERFIDEAVN
EAARQSGDADRSIFDFVRSALRGEAVASAPAALGERVRRFAVRFQQFSAPVAAKGVEDTA
FYRYFPLSSLNEVGGEPDQFGIDVATFHALSADRAKRWPHTMLATSTHDNKRSEDVRNRI
DVLSEMPDEWMQALSRWHGLCRGARKKLETGEAPSRADEYLLYQTLLGALPLGGLDAATA
PAFADRIWQYMQKAAREAKLRTRWSHPDADYEAALEGFVRELLADAKEGGCLADIQRLAD
RLAWFGAWNSLTLTLLKYGSPGVPDLYQGSELIELSLVDPDNRRPVDYALRQQQLDGLHA
MADQDGLAARIGDLAAAPHDGRAKLWFIWRLLSLRGRHPLLFREGGYEPLVVEGPMARHV
VAFARQHEGQTLVIVAGRLFVGLSADAAAAPTLPPAAAWNGTTVRLPEGLGTAALGNLLT
GESIPVDAGARTVRLADAFRHMPWAALVIESGP
NT seq 5142 nt NT seq  +upstreamnt  +downstreamnt
atggtggatgaggcgaatcacggcccggtcggcggcgatctcgggcggttgtgcgaacac
ttcggcattgcgacaggttatttcgacgctttcggcgtgcggtgcgaagtctccgcacgg
agcctcgtcgcgctgctcggcgaattcggcgtgaagctcgacaacgcgggcgatgcaggc
cgtgcactcgacgtagcacgccgtgcgcgctgggccgaggcattgccgcctgtgcaggtc
gtgcaggccggcaatcccgcatggtcggtgacgctgcgggtgccggcttcgatgggccgg
ctgcgctggcggatcggcgacgagcacggacgggaagtcgaaggcgaggtcgatgccgac
acgctgcatgaaaacggccgaagcgagatcgacggaacgctgctgtgcgaacgcgtgctg
catgtgccgctcgcgctcgaagccggctaccaccggctgcgcatcgagggccttcgcggc
gaaacgctgctgctcgccacgccgggccactgctatcggccgcccgcggtgcgcgagggc
ggccgcgtctggggcacggcggtgcagctctacagcctgcgctcgccgcgcaactggggc
atcggcgatttcggcgatctggaagacctcgcggtgcgcatgtcggcgcagggtgccgac
gtgatcggcctcaacccgctgcatgcgctgttcgcgagcacgccgtcgaacgcgagcccg
tacagcccgtcgtcgcgccagcaactcaacgtgctctacatcgatgtcgaagcggtcgac
ggcttcgcggactgcgcgccggcccgcgaccgggtgcattcgcccgacttccaggcgcgg
ctcgcggcactgcgcgcggcgccgttggtcgactacgccggcgtggcccaggccaagttc
gaagtgctggccttgctcttcggcgatttctgcgcgcggcacctgcccgccgagggcgcg
cccagcgaggagggccgggcattcctggccttcgtcgcggagcgcggcgaggcgctgcgg
cagcacgcgctgttcgaaacgctgcaggcccactttcttgagaccgaaggcggcgcgtgg
gattggcacgactggcccgcggcctggcgcgacgccgattctgccgaggtgaccgccttt
gccgtcgcgcacgcacagcgcgtgcagttccaccagtacctgcaatggctcgcgacgcgg
caactggcgcgggtggcggcacgctgcgaagcgctcggcatgggcgtcggcctgtacgtg
gatctcgcggtgtcggtcgaccgcgccggctccgacacctggggcgcgcagcgggtgttc
gcggacggcgccagcgtcggcgcgccgcccgacgagttcaaccccgcgggccagggctgg
ggcctgccgccgctgcggcccgaccgcctgcgtgaagacggctaccgcttcttcatcgag
acgctgcgcgccggcatgcgcggcgcgggcgcactgcgcatcgaccatgtgatgggactg
atgcggctcttctggattccgcagggccgcagcgcccgcgagggcgcgtacgtgtattac
ccgctcgcggagatgctggccatcgtcgcgatcgagagccaccggcaccgctgcatggtc
gtgggcgaagacctcggcaccgtcgaggacgcggtgcgcgaggcgctggcccgtgcagac
gtgctctcgtaccggctgctgtatttcgagaagcgccacgacggcggcttcaagccgccg
gaggcctatccggcggctgcgctggttgcaatcagcacgcacgacctcgcgaccttcgcc
gggtggtggaccgccgccgacctgcgcgagcggctcgcgctcgacctgttccccgacccc
gccatcttcgacaagcaattgatggaccgggcgcgggagcgcatcgaactgacgcaggcc
ttgcagcacgccggactgctctcgcgcgaggaggcggcagaggccgcagggctcgcgatg
ccgtcgccgcgcctcgtcgaggcggcgcatgccttcctggccgcgacgccctcggcgctg
ctgatggtgcagctcgaagacgtggccggcgtggtggcgcaggccaacatgcccggcacg
gtggaccagcatccgaactggcggcgcaagctccccgaaccggtcgccgtgctggcgaac
ggcgacggcatgcgcgggctgggcgaggcgctgcgcgcagcgcggccacgccgcatcgat
gccggcgaaggcgaatcgcccggcctgcagacccgcgtgccgcgcgccacctaccggctg
cagttccacaaggacttcggcttcgacgatgcgatccgcgtgctgccgtaccttgcgaag
ctgggggtgagccatgtgtactgctcgccgatccagcgcgcgcggccgggcagcatgcat
ggctacgacgtggtggcgcatgccgaggtgaaccccgagcttggcggcgaggagggcttt
gcgcgcttcgtcgcggcgctgaaggcgaacggcctcggccagttgctggacatggtgccc
aaccacatgggcgtgttcggcgccgacaacgcgtggtggatggacgtgctggagaacggg
ccggcttcgctttttgcgcagcacttcgacatcgactggcatccgctcaatgtcgagctg
accggcaaggtgctgctgccggtgctgggcgtgcactacggcgaggcgctggacaacggc
gagctcgtgctgcgcttcgaggacgccacgggcagcttcgccgtcacctattacgaccat
cggtttccgcttgcgccggagagctatccggtggtgctggagcgggcgctctcgcggctc
ggcgatgcggcggctgcggcgcggctcgccagcctttcgacggcgttcgggcacctgccg
ccgcgggacacgagcgatccgaaggcgcaggccgaacgcgtgcgcgacaaggaactgctc
aaggcccggctcgcgcgcctcgcggagcgccatccggcggttgccgaggcgctcgtcgct
tccgtggcggagctgaacctcgcgtcgcccgaagcgcgcgatgcgctgcaccggctcatc
gaactgcaggccttccggctcgcgcattggcgcgtggcggcggacgagatcaactaccgg
cgcttcttcgacatcaacgacctcgcggcggtgcggatggagcgcgacgaggtgttcgag
gccacccagtcgttcgcgctggacctcgcggcgtcgggcatggtggacggcttgcgcatc
gaccacccagacgggctctacgacccggcggactacttccgcaagctccaggaaggctac
gcccggcgcgccggactggtgctgccgacgcacgatgcagagggccggcccgcgcggccg
ctgtacgtggtcgccgaaaagatcgcgggcgcgcacgaggaagtgcctgagagctggcat
gtgcacggcaccaccggctaccgcttcgccaacgtggcgaacggcgtgctggtcgacacc
gccgccgaggccgccgtgctgcatgcatggcagcgcttcaccggcgagacggaggacttc
gccgcgatgtcgcgcgccggccggcgcgaggtgatgcgcaatgcgctgtcatcggaactg
aacgtgctttcgaccgagctgctgcgcatcgcgcgggctgaccgcagcacgcgcgactac
acgctcaatgcgctgaggcgcgcgctggccgaggtcggcgcgtgcatgccggtgtaccgg
acctacatcgtcgagcacccgtcggcgcaggacgagcgcttcatcgacgaggccgtgaac
gaggccgcgcgtcagagcggcgatgccgaccgcagcatcttcgacttcgtgcgcagcgcg
ctgcgtggcgaagccgtcgcttcggcgccggccgcgctcggcgagcgggtgcggcgcttc
gcggtgcgcttccagcagttcagcgcgccggtggcggcgaagggcgtggaagacacggcg
ttctaccgctactttccgctcagttcgctcaacgaggtgggcggagagcccgaccagttc
ggcatcgacgtggcgaccttccatgcgctcagtgccgaccgcgcgaagcgctggccgcac
accatgctcgcgacttcgacgcacgacaacaagcgctccgaagacgtgcgcaaccgcatc
gacgtgctctcggagatgcccgacgaatggatgcaggcgctgagccgctggcacggcctg
tgccgcggcgcgcgcaagaagctggaaaccggcgaggcgccgtcgcgcgccgacgaatac
ctgctgtaccagacgctgctgggcgccttgccgctgggcgggctcgacgcggccaccgcg
ccggccttcgccgaccgcatctggcagtacatgcagaaggccgcgcgcgaagccaagctg
cgcacgcgctggtcgcatcccgatgccgactacgaagccgcgctcgaaggcttcgtgcgc
gagctgctggccgatgcgaaagagggcggctgcctcgccgacatccagcgcctcgcggac
cggctcgcctggttcggcgcatggaacagcctcacgctcacgctgctgaagtacggctcg
cccggcgtgcccgatctctaccagggcagcgagctcatcgaactgagcctggtcgatccc
gacaaccggcggccggtggactacgcgctgcggcagcagcagctcgatgggctgcatgcg
atggccgaccaggacgggctcgccgcgcgcatcggcgacctggctgctgcgccgcacgat
gggcgcgcgaagctctggttcatctggcgattgctgtcgctcaggggccggcatccgctg
ctgtttcgcgaaggcggctacgagccgctggtggtcgaagggccgatggcgcggcatgtc
gtggcgttcgcgcgccagcatgaggggcagacgctggtgattgttgcgggccggttgttc
gtcgggctatcggcggacgccgcagcagcgccaacgctgccgccggccgcggcttggaac
ggcacgacggtgcggctgcccgaagggctcggcacggcggcgcttggcaacctgctgacc
ggtgaatccattccggtcgatgcaggtgcgcgcacggtgcggctggccgacgccttccgc
cacatgccgtgggcggcgctggtgatcgaaagcggtccctga

DBGET integrated database retrieval system