KEGG   Variovorax paradoxus EPS: Varpa_3069Help
Entry
Varpa_3069        CDS       T01392                                 

Definition
cheb methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Varpa_3069
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Varpa_3069
Enzymes [BR:vpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Varpa_3069
Two-component system [BR:vpe02022]
 CheA family
  CheA-CheYBV
   Varpa_3069
Bacterial motility proteins [BR:vpe02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Varpa_3069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3312531..3313637
Genome map
AA seq 368 aa AA seqDB search
MNAASIPAPTAHGASTHFAFTAMTTNNEKPLPPTRTPARAIFIGASSGGVYAMLELAAAL
PANFPVPVFLVQHIGAHRSQLAQLLSARGPNPAVAANDGDAPAAGTIHVAPPDHHMLLEG
GVIRVTRGPKEHHARPAIDPLFRSAALEMGAGAIGVVLTGMLEDGSAGLRAIKDCGGTVV
VQDPADAFEPGMPRAALSVVRADHVVPLSQMADLLLALAREERVVPADRNLAPLPALRRE
HALGKGGHTVENLKEIATPSTFSCPDCGGVLFELDDKRPVRYRCHTGHAFGLRSLAATQE
QVTDAALWTGLRVLQEKEAILRRLAEVQRESDAAAAADCDREADEIAQVANAMRKLTVKA
PSPASFEA
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccgcatccataccggcgccgaccgcgcacggggcctccacccacttcgcgttc
acggccatgacaacgaacaacgaaaaacctctgccccccacccgcaccccggcgcgcgcc
atcttcatcggtgcctcgtcgggcggcgtgtacgcgatgctcgaactcgcggcggcgctg
cccgcgaactttccggtgccggtgttcctcgtgcagcacatcggcgcgcaccgcagccag
ctcgcgcagctcctgagcgcgcgcgggcccaaccccgccgtggcggcgaacgacggcgat
gcgccggccgccggcaccatccacgtcgcgccgcccgaccaccacatgctgctcgaaggc
ggtgtgatccgcgtgacccgcggcccgaaggaacaccatgcacgccccgccatcgacccc
ctgtttcgttcggccgcgctggagatgggcgcgggcgccatcggcgtggtgctcaccggc
atgctcgaagacggcagcgcgggcctgcgcgccatcaaggactgcggcggcacggtcgtc
gtgcaggacccggccgacgccttcgagccgggcatgccgcgcgccgccctgtcggtggtg
cgcgccgaccacgtggtgccgctgtcgcagatggcggacctgctccttgcgctggcccgc
gaagaacgcgttgtacccgccgaccggaacctcgcgccattgcccgcgctgcgccgcgag
catgccttgggcaagggggggcacaccgtggaaaacctgaaggaaatcgcgacgccttcg
accttcagctgccccgactgcggcggcgtgctgttcgaactggacgacaagcggccggtg
cgctaccgctgccacaccggccacgccttcggcctccgcagcctggccgcgacccaggag
caggtgaccgatgccgcgctgtggacgggcctgcgcgtgctgcaggaaaaagaagcgatc
ctccggcgcctggccgaagtgcagcgcgagagcgacgccgcggcagccgcggattgcgat
cgcgaagccgatgaaatcgcgcaggtcgccaacgcgatgcgcaagctcacggtgaaggcg
cccagccccgcgagcttcgaggcgtag

DBGET integrated database retrieval system