KEGG   Variovorax paradoxus EPS: Varpa_3210Help
Entry
Varpa_3210        CDS       T01392                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:vpe00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3455335..3456573
Genome map
AA seq 412 aa AA seqDB search
MPTAASPPSIDTCIGTRIGRRPLLAAAALGWAASRPAFAAPPAAACHPASDWAAFAARHI
QRDGRVIDFNTPQQQSTSEGQSYSLFFALVHNDKPTFARVLAWTEANLAQGSLASNLPAW
QWGKKPDGGWGVLDANAASDADLWIAYALMEAGRLWNEPRYAKLGRSLLALVVRDEVVAL
PGLGRMLLPWPASVASGPVWRLNPSYMPLQLLQYFHHADPRGPWREVADNTLRLLDAVAL
KGFAPDWCGWSQTANAFVADPEKGTVGSYDAIRVYLWAGMLSPRAPEHKALMQRLNGPRQ
LVAEHRPMPESVDTATGAGRGTGPVGFAGALLPYLKAQALPDVLATESARLPGGRAEIPS
AAATGAPMPPMPYYEQVLSIFGQAWLDGRYEFDRSGQLQTSWRLLCRPTRAA
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccgccgcatcgccgccatccatcgacacgtgcatcggcacgcgcatcggcagg
cggccgctgctcgccgcggcggcgctgggctgggcggcgtcgcgcccggccttcgcggcg
ccgccggccgcggcgtgccatccggcgtccgactgggccgcgttcgccgcgcgccacatc
cagcgcgacgggcgcgtgatcgacttcaacacgccgcagcagcagtcgacctccgagggg
cagtcgtacagcctcttcttcgcgctggtccacaacgacaagccgaccttcgcgcgcgtg
ctcgcctggaccgaagccaacctcgcgcagggcagcctggccagcaacctgccggcctgg
caatggggcaagaagcccgacggcggatggggcgtgctcgatgcgaatgccgcctccgat
gccgacctgtggatcgcctatgcgctcatggaagccggccggctctggaacgagccgcgc
tacgcgaagctcgggcgcagcctgctggcgctggtggtgcgcgacgaagtggtggcgctc
cccgggctcggccgcatgctgctgccctggcccgcgtcggtggcgagcggtccggtctgg
cgactcaacccgagctacatgccgctgcagttgctgcagtacttccaccatgccgatccg
cgcggaccgtggcgcgaagtggcggacaacaccctgcgcctgctcgacgccgtcgcactc
aagggcttcgcgcccgactggtgcggctggtcgcagacggccaatgccttcgtcgccgat
cccgagaagggcaccgtcggcagctacgacgccattcgcgtctatctctgggccggcatg
ctgtcgcccagggcgccggaacacaaggcattgatgcagcgcctgaacggcccgcgccaa
ctggttgcggagcatcgcccgatgcccgaatcggtggacaccgccaccggtgccgggcgc
ggcaccgggccggtcggtttcgccggcgcgctgctgccttatctgaaagcgcaggctctg
cccgatgtgctggccaccgagtcggcccggctcccgggcggacgcgccgaaattccatcg
gcggcggctacgggcgctccgatgcctccgatgccttattacgagcaggtgctgtcgatc
ttcggacaggcctggctggacggccgctacgaattcgatcgcagcggccagttgcaaacc
tcatggagactgctatgtcgacccacccgagcggcatga

DBGET integrated database retrieval system