KEGG   Variovorax paradoxus EPS: Varpa_3210Help
Entry
Varpa_3210        CDS       T01392                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Varpa_3210
Enzymes [BR:vpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Varpa_3210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3455335..3456573
Genome map
AA seq 412 aa AA seqDB search
MPTAASPPSIDTCIGTRIGRRPLLAAAALGWAASRPAFAAPPAAACHPASDWAAFAARHI
QRDGRVIDFNTPQQQSTSEGQSYSLFFALVHNDKPTFARVLAWTEANLAQGSLASNLPAW
QWGKKPDGGWGVLDANAASDADLWIAYALMEAGRLWNEPRYAKLGRSLLALVVRDEVVAL
PGLGRMLLPWPASVASGPVWRLNPSYMPLQLLQYFHHADPRGPWREVADNTLRLLDAVAL
KGFAPDWCGWSQTANAFVADPEKGTVGSYDAIRVYLWAGMLSPRAPEHKALMQRLNGPRQ
LVAEHRPMPESVDTATGAGRGTGPVGFAGALLPYLKAQALPDVLATESARLPGGRAEIPS
AAATGAPMPPMPYYEQVLSIFGQAWLDGRYEFDRSGQLQTSWRLLCRPTRAA
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccgccgcatcgccgccatccatcgacacgtgcatcggcacgcgcatcggcagg
cggccgctgctcgccgcggcggcgctgggctgggcggcgtcgcgcccggccttcgcggcg
ccgccggccgcggcgtgccatccggcgtccgactgggccgcgttcgccgcgcgccacatc
cagcgcgacgggcgcgtgatcgacttcaacacgccgcagcagcagtcgacctccgagggg
cagtcgtacagcctcttcttcgcgctggtccacaacgacaagccgaccttcgcgcgcgtg
ctcgcctggaccgaagccaacctcgcgcagggcagcctggccagcaacctgccggcctgg
caatggggcaagaagcccgacggcggatggggcgtgctcgatgcgaatgccgcctccgat
gccgacctgtggatcgcctatgcgctcatggaagccggccggctctggaacgagccgcgc
tacgcgaagctcgggcgcagcctgctggcgctggtggtgcgcgacgaagtggtggcgctc
cccgggctcggccgcatgctgctgccctggcccgcgtcggtggcgagcggtccggtctgg
cgactcaacccgagctacatgccgctgcagttgctgcagtacttccaccatgccgatccg
cgcggaccgtggcgcgaagtggcggacaacaccctgcgcctgctcgacgccgtcgcactc
aagggcttcgcgcccgactggtgcggctggtcgcagacggccaatgccttcgtcgccgat
cccgagaagggcaccgtcggcagctacgacgccattcgcgtctatctctgggccggcatg
ctgtcgcccagggcgccggaacacaaggcattgatgcagcgcctgaacggcccgcgccaa
ctggttgcggagcatcgcccgatgcccgaatcggtggacaccgccaccggtgccgggcgc
ggcaccgggccggtcggtttcgccggcgcgctgctgccttatctgaaagcgcaggctctg
cccgatgtgctggccaccgagtcggcccggctcccgggcggacgcgccgaaattccatcg
gcggcggctacgggcgctccgatgcctccgatgccttattacgagcaggtgctgtcgatc
ttcggacaggcctggctggacggccgctacgaattcgatcgcagcggccagttgcaaacc
tcatggagactgctatgtcgacccacccgagcggcatga

DBGET integrated database retrieval system