KEGG   Variovorax paradoxus EPS: Varpa_3302Help
Entry
Varpa_3302        CDS       T01392                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vpe00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3553555..3554475)
Genome map
AA seq 306 aa AA seqDB search
MKSSNNGASGPVFHGEPGGSVWQTSRFRIDLAQPRVMGIVNVTPDSFSDGGAHASTDTAL
RHCEQLLKEGADILDIGGESTRPGSPAVPLDAELARVLPVVREAVKLNVPLSIDTYKPEV
MRAVLDLGADIVNDIWALRQPGAREAVAAHPSCGICLMHMHRDPQTMQVVPMQGDVIPEV
LSFWAAQLAQLHALQIDPSRITLDPGVGFGKTVTQNFALLGRQRELLGAGYPLLLGWSRK
SSIGTATGIEAAGERIVPSVAAAVLAVDRGAAIVRVHDVRDTVAALAVWRAMKAAAQQRQ
TKEELA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatcaagcaacaacggggcctctggccccgttttccatggtgagccgggcggctcg
gtctggcagacctcgcgtttcaggatcgacctcgcgcagccgcgcgtcatgggcatcgtc
aacgtcacgcccgattccttctccgatggcggcgcgcacgcgtccaccgacaccgcgctg
cggcactgcgagcagttgttgaaggagggcgcggacatcctggacatcggcggggaatcc
acccgcccgggcagcccggccgttccgctcgacgccgaactggcgcgcgtgctgccggtt
gtgcgcgaggcggtgaagctgaacgtgccgctctccatcgacacctacaagcccgaggtc
atgcgcgctgtgctcgacctgggcgcggacatcgtcaacgacatctgggcgctgcgccag
ccgggtgcgcgtgaagccgtggcggcgcatccgtcgtgcggcatctgcctgatgcacatg
caccgcgatccgcagaccatgcaggtcgtgccgatgcagggcgacgtgatccccgaggtg
ctgtcgttctgggccgcgcagctggcgcaactccacgcgctgcagatcgatccgtcgcgc
atcacgctcgacccgggcgttggcttcgggaaaaccgtgacgcagaatttcgccctgctg
ggccggcagcgcgaattgctcggtgccggctacccgctgctcctgggctggtcgcgcaag
tcgtcgatcggcaccgccactggcatcgaggcggcgggcgagcgcatcgtgcccagcgtc
gcggccgcggtgctggccgtggaccgcggcgccgccatcgtgcgcgtgcacgatgtgcgc
gacacagtggccgccctcgcggtgtggcgcgccatgaaggcagcagcacaacaaagacaa
acaaaagaggaactcgcatga

DBGET integrated database retrieval system