KEGG   Variovorax paradoxus EPS: Varpa_3394Help
Entry
Varpa_3394        CDS       T01392                                 

Definition
malonyL-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
vpe  Variovorax paradoxus EPS
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Varpa_3394
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Varpa_3394
Enzymes [BR:vpe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Varpa_3394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3656602..3658068)
Genome map
AA seq 488 aa AA seqDB search
MSATEWFQARLRSGEKSKVPVALESIAKSVPKNTLKPSERTTAERLQVTLRKADEALSPR
ALRRVLADLQAVIDPRVSEVEGGRRAHAIAEAYAAATPEERRDYWALMSEHFAADAQKLK
TARDQHQAAVGTPDEGQAEMKLRRALVSPRMRLLQRFAVEPTGMRFLVDLRAGLLPCLKA
DKRLLALDAELEQLFSTWFDVAFLELRRIDWDSPASLIEKLIRYEAVHDIKSWSDVKNRL
DDSDRRCYGFFHPRLPNEPLIFVEVALVDRISDGITPLLDEAAVPVLPAKATTAIFYSIS
NTQNGLRGVSFGDSLIKRVVETLQDELPRLKTFATLSPIPGFRTWLAKNAADLLPRLDEK
REVELGRLVGSVPPTAERLLAAVEAAATFDAKSPLRQWLLQAAAEYLGRALVDGTPADPV
ARFHLGNGARVERLNWAGDPSPKGHKQSYGLMVNYLYDLKRLDKHRTWLGDGKVAVSGDI
ESLFFKKG
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgaccgaatggttccaggcgcggctgcgttctggcgaaaagtccaaggtgccc
gtggcgctcgagagcattgccaagagcgtgccgaagaacacgctcaagcccagcgagcgc
acgaccgccgagcgcctgcaggtcacgctgcgcaaggccgacgaggccctgtcgccgcgc
gcactgcgccgcgtgctggccgacctgcaggccgtgatcgatccgcgcgtgagcgaggtc
gaaggcggccgccgggcccacgccatcgcggaggcctatgccgcggccacacccgaggag
cgccgcgactactgggcgctgatgagcgagcacttcgccgccgatgcgcaaaagctcaag
accgcgcgcgaccagcaccaggccgcggtcggcacgcccgacgaagggcaggccgaaatg
aagctgcgccgcgcgctcgtctcgccgcgcatgcgccttctgcagcgcttcgcggtcgag
cccacgggcatgcgctttctggtcgacctgcgcgccggcctgctgccgtgcctgaaggcc
gacaagcgcctgcttgcgctcgatgccgaactcgagcaactcttctccacctggttcgac
gtcgccttcctcgagctgcgccgcatcgactgggattcgccggcctcgctgatcgagaag
ctcatccgctacgaggcggtgcacgacatcaagagctggtccgatgtgaagaaccggctg
gacgacagcgaccgccgctgctacggcttcttccacccgcgcctgcccaacgagccgctg
atctttgtcgaggtggcgctggtcgaccgcatcagcgacggcatcacgccgctgctcgac
gaggcggccgtaccggtgctgcccgccaaggcgaccaccgcgatcttctattcgatcagc
aacacccagaatggcctgcgcggcgtgagcttcggcgattcgctcatcaagcgcgtggtc
gagacgctgcaggacgaactgccgcgcctgaagacctttgccacgctctcgccgattccg
ggctttcgcacctggctcgccaagaacgccgccgacctgctgccgcgcctcgatgaaaag
cgcgaggtcgaactcggccgcctcgtcggctcggtgccgcccacggccgagcgcctgctc
gccgccgtggaagctgccgccaccttcgatgccaagtcgccgctgcgccaatggctgctg
caggcggccgccgagtacctgggccgtgcgctggtcgacggcacgccggccgacccggtc
gcgcgcttccacctgggcaacggtgcacgggtcgaacggttgaactgggcgggcgatccc
tcgcccaaggggcacaagcagtcgtatggcctcatggtcaattacctgtacgacttgaag
cgcctcgacaagcatcggacctggctgggcgacggcaaggtcgcggtatcgggagacatc
gaaagcctgttcttcaaaaaaggctga

DBGET integrated database retrieval system