KEGG   Variovorax paradoxus EPS: Varpa_3684Help
Entry
Varpa_3684        CDS       T01392                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Varpa_3684
Enzymes [BR:vpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Varpa_3684
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Varpa_3684
Lipid biosynthesis proteins [BR:vpe01004]
 Fatty acid synthase
  Component type
   Varpa_3684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3974377..3974973
Genome map
AA seq 198 aa AA seqDB search
MAAAHAQSTATGKPVILVLGDSLSAEYGLKRGEGWVPLLEKRLAQQKIAATVVNASISGD
TSSGGRARFPALLTQHKPSHVVVELGANDALRGLPLSDTEANLLQITKAAQAAGAKVLIV
GIQVPPNYGGDYTRRFEAVFSKVAGATKSALVPFLLKGVADAPNAMSLFQADRIHPTAVA
QPQLLDNVWPELRKLLPK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggcgcacgcccagtcgaccgcaaccggcaagccggtcatcctggtgctgggc
gattcgctgagcgcagagtacggcttgaagcgcggcgaaggctgggtacccttgctggaa
aaaaggcttgcccagcagaagatcgcggccaccgtggtcaacgccagcatcagcggcgac
accagttccggcggacgcgcccgcttccccgccctccttacacaacacaagcccagccac
gtggtggtggagctcggcgccaacgatgcgctgcgcggcctgccgctctcggacaccgag
gccaacctgctgcagatcaccaaggccgcgcaggccgcgggcgcgaaggtgctgatcgtc
ggcatccaggtgccgccgaactacggcggcgactacacgcggcgcttcgaggcggtgttc
tcgaaggtggcgggcgcgaccaagtcggcgctcgttcccttcctgctcaagggcgtggcg
gatgcgcccaatgcgatgtcgctgttccaggccgaccgcatccacccgacggccgtggcg
cagccgcagttgctcgacaacgtctggcccgaactgcgaaagctgctgcccaagtaa

DBGET integrated database retrieval system