KEGG   Variovorax paradoxus EPS: Varpa_3718Help
Entry
Varpa_3718        CDS       T01392                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, e2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Varpa_3718
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Varpa_3718
  Amino acid metabolism
   00310 Lysine degradation
    Varpa_3718
Enzymes [BR:vpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Varpa_3718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4007423..4008688)
Genome map
AA seq 421 aa AA seqDB search
MSIVEVKVPQLSESVAEATMLTWKKKAGEAVAVDEILIEIETDKVVLEVPAPSAGVLAEI
VQPDGATVVADQLIAKIDTEGKASAAAPAAAPAAAAPAAAAPAPAAAAAATGGSKSDVAM
PAAAKLLADNNLKTGDVVGTGKDGRVTKGDVLGAVASGAKPAAAAIPAPAAKPALPQVAS
PVGSSDLGERPEQRVPMSRLRARIAERLIQSQSTNAILTTFNEVNMAPVMELRKRFQDSF
IKEHGVKLGFMSFFVKAAVHALKKYPVINASVDGNDILYHGYFDIGIAVGSPRGLVVPIL
RNADQMSFADIEKKIAEYGKKAQDGKLGIEEMTGGTFSISNGGTFGSMLSTPIINPPQSA
ILGVHATKDRAVVENGQIVIRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPSRLLFD
I
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcgtagaagtcaaagtcccccagctttccgaatccgtggccgaagccaccatg
ctcacctggaagaagaaggccggcgaagccgtcgccgtcgatgaaatcctgatcgagatc
gagaccgacaaggtcgtgctggaagtgcccgccccctcggccggcgtgctggccgaaatc
gtgcagcccgatggcgccaccgtggtggcggatcagctgatcgccaagatcgacaccgaa
ggcaaggccagcgccgctgccccggctgcagcacctgctgccgctgctccggctgctgcc
gcgcctgctccggcagccgctgccgccgccaccggcggttcgaagtcggacgttgccatg
cccgccgccgccaagctgctggccgacaacaacctcaagaccggcgacgttgtcggcacc
ggcaaggacggccgcgtgaccaagggcgacgtgctcggtgcagtggcttcgggcgccaag
cctgccgctgccgccatccccgcaccggctgccaagcccgcactgccgcaggtcgcctcg
ccggtcggttcgtccgacctcggagagcgtccggaacagcgcgtgccgatgagccgcctg
cgcgcccgcatcgccgagcgcctgatccagtcgcagtcgaccaacgcgatcctgaccacc
ttcaacgaagtgaacatggcgcccgtcatggaactgcgcaagcgcttccaggacagcttc
atcaaggaacacggcgtgaagctcggcttcatgtccttcttcgtgaaggccgcggtgcac
gcactgaagaagtacccggtgatcaacgcctcggtcgacggcaacgacatcctgtaccac
ggctacttcgacatcggcatcgccgtcggttcgccgcgcggcctggtcgtgccgatcctg
cgcaacgccgaccagatgagctttgccgacatcgagaagaagatcgccgagtacggcaag
aaggcgcaagacggcaagctgggcatcgaagagatgaccggcggcacgttctccatctcg
aacggcggcaccttcggctcgatgctctcgacgccgatcatcaacccgcctcagtcggcc
atcctcggcgtgcacgccaccaaggaccgcgctgtggtggagaacggccagatcgtcatc
cgtccgatgaactacctggccatgagctatgaccaccgcatcatcgacggccgcgaagcc
gtgctgggcctggtcgcgatgaaggaagcgctggaagatccgtcgcgcctgctgttcgat
atctga

DBGET integrated database retrieval system