KEGG   Variovorax paradoxus EPS: Varpa_3729Help
Entry
Varpa_3729        CDS       T01392                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00010  Glycolysis / Gluconeogenesis
vpe00020  Citrate cycle (TCA cycle)
vpe00620  Pyruvate metabolism
vpe01100  Metabolic pathways
vpe01110  Biosynthesis of secondary metabolites
vpe01120  Microbial metabolism in diverse environments
vpe01130  Biosynthesis of antibiotics
vpe01200  Carbon metabolism
Module
vpe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Varpa_3729
   00020 Citrate cycle (TCA cycle)
    Varpa_3729
   00620 Pyruvate metabolism
    Varpa_3729
Enzymes [BR:vpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Varpa_3729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N NQRA FAP
Motif
Other DBs
NCBI-ProteinID: ADU37913
JGI: Varpa_3729
UniProt: E6V0W7
Position
complement(4022155..4023834)
Genome map
AA seq 559 aa AA seqDB search
MAAVEVKVPDIGDFDEVAVIEVLVKVGDTVKAEQSLITVESDKASMEIPSSTAGVVKEIK
VEIGGKVKEGSVVLVLEAEGAAAAPAPAPAAAPAPAAAAPAPAATAPAPAAAPAAASGPV
EIKVPDIGDFKDVAVIELLVKPGDTIAADQSLITVESDKASMEIPSSGAGVLKELKVKVG
DTVNIGDLIAILEGSAGAAAPAPAQAAAAAPAAATASAPAPAAASPAPAASPAAAAAPHD
PTTAPSANLPHASPSVRKFARELGVPLEEVKGSGPKGRITQEDVQGFTKAVMSGQASTKA
SAAKAPAGGGSADGAALGLIPWPKVDFAKFGAVERKDLSRIKKLSGANLHRNWVMIPHVT
NNDEADITELEAFRVSTNKENEKSGVKVTMLAFVIKAVVAALKKFPDFNASLDGDQLVYK
QYFNIGFAADTPNGLVVPVLKDADKKGILQISAEMGELAKKARDGKLGSADMQGGCMSIS
SLGGIGGTHFTPIINAPEVAILGLSKGQMKPVWDGKQFVPRLTLPLSLSYDHRVIDGALA
ARFNAYLGQVLADYRRILL
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagtggaagtgaaggtgccggacatcggcgatttcgatgaagtcgcggtgatc
gaggtgctggtgaaggtgggcgacacggtcaaggccgagcagtcgctcatcacggtggaa
tcggacaaggcgtcgatggagattccttcttcgacggccggtgtggtcaaggaaatcaag
gtcgagatcggcggcaaggtgaaagagggctcggtggtgctcgtgctggaggccgaaggt
gccgccgccgcaccggcccccgcgcctgcagcagctccggctcctgcggctgccgctccg
gcacccgcagccacggcgcctgcaccggctgccgcgcccgcagcagcctccggaccggtc
gagatcaaggtgccggacatcggcgatttcaaggacgtcgcggtcatcgaactgctggtc
aagcccggcgacacgatcgcggccgaccagtcgctgatcacggtggagtcggacaaggcc
tcgatggagattccgtcgtcgggtgccggcgtgctgaaggagctcaaggtcaaggtcggc
gacacggtcaacatcggtgacctgatcgcgatcctggaaggttcggcaggtgctgccgca
cccgcgcctgcgcaagctgccgcagcagccccggccgcggcaaccgccagcgcccccgcg
ccggccgctgcttcgccggcgccggccgcaagcccggcagccgccgctgcaccgcacgat
cccaccacggcgcccagcgccaacctgccgcacgcttcgccgtcggtacgcaagttcgcc
cgcgaactcggcgtgccgctcgaagaggtcaagggctccggtcccaagggccgcatcacg
caggaagacgtccagggcttcaccaaggccgtgatgagcggccaggccagcaccaaggcc
tcggcggccaaggcgccggccggtggtggcagcgcggatggcgcggcgctgggcctcatt
ccgtggcccaaggtcgacttcgccaagttcggcgcggtcgagcgcaaggacctatcgcgc
atcaagaagctcagcggcgcgaacctgcaccgcaactgggtgatgattccgcacgtcacc
aacaacgacgaagccgacatcaccgagctcgaggccttccgcgtctccaccaacaaggag
aacgaaaagtcgggcgtgaaggtcacgatgctggccttcgtgatcaaggcggtggtcgcg
gcgctgaagaaattccccgacttcaacgccagcctggatggcgaccagctcgtctacaag
cagtacttcaacatcggcttcgcggcggacacgcccaacgggctcgtggtgccggtgctg
aaagatgccgacaagaagggcattctgcagatcagcgccgagatgggcgagctcgccaag
aaggcgcgcgacggcaagctcggctcggccgacatgcagggcggctgcatgtcgatcagc
tcgctcggcggcatcggcggcacgcacttcacgcccatcatcaacgcccccgaagtggcc
atcctcggcctctccaagggccagatgaaaccggtgtgggacggcaaacagttcgtgccg
cgcctgacgctgccgctgtcgctgtcttacgaccaccgcgtgatcgacggggctctggct
gcgcgcttcaacgcctaccttgggcaagtgctcgcggactaccgtcgaatcctgctatga

DBGET integrated database retrieval system