KEGG   Variovorax paradoxus EPS: Varpa_3760Help
Entry
Varpa_3760        CDS       T01392                                 

Definition
acetyL-CoA carboxylase, biotin carboxylase
Orthology
K01965  
propionyl-CoA carboxylase alpha chain [EC:6.4.1.3]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:vpe01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:vpe00630]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:vpe00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:vpe00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4055249..4057297)
Genome map
AA seq 682 aa AA seqDB search
MFKKILIANRGEIACRVIQTAKKMGILTVAVYSDADKEARHVELADEAVHIGAAPSRESY
LQADRIIAACKQTGAEAVHPGYGFLSENEAFARKVEEEGIAFIGPKHYSIAAMGDKIASK
KLANEAKVNTIPGWNDAIETAERAVEIAKDIGYPVMIKASAGGGGKGLRVAFNDKEAFEG
FTSCRNEARNSFGDDRVFIEKFVEEPRHIEIQVLGDSHGNVIYLNERECSIQRRHQKVIE
EAPSPFITDATRKAMGAQAVQLAKAVNYQSAGTVEFVVGKDQSFYFLEMNTRLQVEHPVT
ECITGLDLVELMIRVAAGEKLPLTQEEVKRDGWAIECRINAEDPFRSFLPSTGRLVKFQP
PAETMFASDTEHLNGVRVDTGVYDGGEIPMYYDSMIAKLIVHGKDRQHAIARMREALNGF
VIRGISSNIPFQAALLAHPKFVAGDFNTGFIAEHYGKGFHAEDVPHADPSFLVALAAYVH
RRYRARASGISGQLEGHGVKVGEQFVVVELGPEGKHVHHPVSVTDFHGKTGASAIAVGGK
NYKIDSGSALGAIRVQGMVNDKPFTAQVERGAGKNPLALRVSHDGTQIEAMVLSPLGARL
LELMPYKAPPDLSKFLMSPMPGLLVEVSVEPGQQVRAGEKLAVIEAMKMENVLFATQDGV
VGKISAGKGESLAVDQIILEFN
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagaagatcctgatagccaaccgcggtgagatcgcttgccgcgtcatccagacc
gcgaagaagatgggcatcctcaccgtcgccgtctactccgacgccgacaaggaggcccgc
cacgtcgagctggccgacgaagccgtgcacatcggtgccgcgcccagccgcgagagttat
ctgcaggccgaccgcatcatcgcggcctgcaagcagacgggcgccgaggcggtgcacccg
ggctacggcttcctctcggagaacgaagccttcgcgcgcaaggtcgaggaagagggcatc
gccttcatcggaccgaagcactattcgatcgctgcgatgggcgacaagatcgcctcgaag
aagctcgcgaacgaagccaaggtcaacacgattcccggctggaacgacgccatcgagaca
gccgagcgcgctgtcgaaatcgccaaggacatcggatatcccgtgatgatcaaggcctcg
gccggcggcggcggcaagggcctgcgtgtggccttcaacgacaaggaggccttcgagggc
ttcacctcgtgccgcaacgaggcgcgcaacagcttcggcgacgaccgcgtgttcatcgag
aagttcgtcgaggagccgcgccacatcgagatccaggtgctgggcgattcgcatggcaat
gtgatctacctgaacgagcgcgagtgctcgatccagcggcgccaccagaaggtgatcgaa
gaggcgccttcgcccttcatcaccgatgccacgcgcaaggcgatgggcgcgcaggcggtg
caattggccaaggccgtgaactaccagagcgcgggcacggtggagttcgtggtcggcaag
gaccagagcttctatttcctcgagatgaacacgcggctgcaggtggagcatccggtgacg
gagtgcatcacggggctggacctcgtcgaactgatgatccgcgtcgcggccggcgagaag
ctgccgctcacgcaagaagaggtcaagcgcgacggctgggccatcgagtgccgcatcaac
gccgaagacccgttccgcagcttcctgccttcgaccggccggctcgtgaagttccagccg
cccgccgagaccatgttcgcgagcgacaccgagcacctgaacggcgtgcgcgtggacacc
ggcgtgtacgacggcggcgagatcccgatgtactacgactcgatgatcgccaagctcatc
gtgcacggcaaggatcgccagcacgcgattgcccgcatgcgcgaagcgctcaacggcttc
gtgatccgcggcatcagcagcaacatcccgttccaggcggcgctgcttgcgcatccgaag
ttcgtggcgggcgacttcaacaccggcttcatcgccgagcactacggcaagggcttccat
gcggaagacgtgccgcacgccgatccgtcgttcctcgttgcgctcgcggcctatgtgcac
cgccgctatcgcgcgcgagcctcgggcatcagcggacagctcgaaggccacggtgtgaag
gtaggtgagcagttcgtggtggtggagctcgggcccgagggcaagcatgtgcatcacccg
gtgtcggtgaccgacttccacggcaagaccggcgcgagcgccattgccgtcggcggcaag
aactacaagatcgacagcggttccgcgctcggcgcgatccgcgtgcagggcatggtcaac
gacaagcccttcaccgcgcaggtcgagcgcggcgcgggcaagaaccctctggcgctgcgc
gtgtcgcacgacggcacgcagatcgaggccatggtgctgtcgccgctgggcgcgcgcctg
ctggagctgatgccctacaaggcgccgccggacctgagcaagttcctgatgtcgccgatg
ccgggcctcctggtcgaggtgtcggtggagccggggcagcaggtgcgcgccggcgagaag
ctggctgtcatcgaggcgatgaagatggaaaacgtgctgttcgccacgcaggacggcgtg
gtcggaaaaatctcggcgggcaagggcgaatcgctcgccgtcgaccaaatcattctggag
ttcaattga

DBGET integrated database retrieval system