KEGG   Variovorax paradoxus EPS: Varpa_3760Help
Entry
Varpa_3760        CDS       T01392                                 

Definition
acetyL-CoA carboxylase, biotin carboxylase
Orthology
K01965  
propionyl-CoA carboxylase alpha chain [EC:6.4.1.3]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Varpa_3760
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Varpa_3760
   00640 Propanoate metabolism
    Varpa_3760
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Varpa_3760
Enzymes [BR:vpe01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.3  propionyl-CoA carboxylase
     Varpa_3760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4055249..4057297)
Genome map
AA seq 682 aa AA seqDB search
MFKKILIANRGEIACRVIQTAKKMGILTVAVYSDADKEARHVELADEAVHIGAAPSRESY
LQADRIIAACKQTGAEAVHPGYGFLSENEAFARKVEEEGIAFIGPKHYSIAAMGDKIASK
KLANEAKVNTIPGWNDAIETAERAVEIAKDIGYPVMIKASAGGGGKGLRVAFNDKEAFEG
FTSCRNEARNSFGDDRVFIEKFVEEPRHIEIQVLGDSHGNVIYLNERECSIQRRHQKVIE
EAPSPFITDATRKAMGAQAVQLAKAVNYQSAGTVEFVVGKDQSFYFLEMNTRLQVEHPVT
ECITGLDLVELMIRVAAGEKLPLTQEEVKRDGWAIECRINAEDPFRSFLPSTGRLVKFQP
PAETMFASDTEHLNGVRVDTGVYDGGEIPMYYDSMIAKLIVHGKDRQHAIARMREALNGF
VIRGISSNIPFQAALLAHPKFVAGDFNTGFIAEHYGKGFHAEDVPHADPSFLVALAAYVH
RRYRARASGISGQLEGHGVKVGEQFVVVELGPEGKHVHHPVSVTDFHGKTGASAIAVGGK
NYKIDSGSALGAIRVQGMVNDKPFTAQVERGAGKNPLALRVSHDGTQIEAMVLSPLGARL
LELMPYKAPPDLSKFLMSPMPGLLVEVSVEPGQQVRAGEKLAVIEAMKMENVLFATQDGV
VGKISAGKGESLAVDQIILEFN
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagaagatcctgatagccaaccgcggtgagatcgcttgccgcgtcatccagacc
gcgaagaagatgggcatcctcaccgtcgccgtctactccgacgccgacaaggaggcccgc
cacgtcgagctggccgacgaagccgtgcacatcggtgccgcgcccagccgcgagagttat
ctgcaggccgaccgcatcatcgcggcctgcaagcagacgggcgccgaggcggtgcacccg
ggctacggcttcctctcggagaacgaagccttcgcgcgcaaggtcgaggaagagggcatc
gccttcatcggaccgaagcactattcgatcgctgcgatgggcgacaagatcgcctcgaag
aagctcgcgaacgaagccaaggtcaacacgattcccggctggaacgacgccatcgagaca
gccgagcgcgctgtcgaaatcgccaaggacatcggatatcccgtgatgatcaaggcctcg
gccggcggcggcggcaagggcctgcgtgtggccttcaacgacaaggaggccttcgagggc
ttcacctcgtgccgcaacgaggcgcgcaacagcttcggcgacgaccgcgtgttcatcgag
aagttcgtcgaggagccgcgccacatcgagatccaggtgctgggcgattcgcatggcaat
gtgatctacctgaacgagcgcgagtgctcgatccagcggcgccaccagaaggtgatcgaa
gaggcgccttcgcccttcatcaccgatgccacgcgcaaggcgatgggcgcgcaggcggtg
caattggccaaggccgtgaactaccagagcgcgggcacggtggagttcgtggtcggcaag
gaccagagcttctatttcctcgagatgaacacgcggctgcaggtggagcatccggtgacg
gagtgcatcacggggctggacctcgtcgaactgatgatccgcgtcgcggccggcgagaag
ctgccgctcacgcaagaagaggtcaagcgcgacggctgggccatcgagtgccgcatcaac
gccgaagacccgttccgcagcttcctgccttcgaccggccggctcgtgaagttccagccg
cccgccgagaccatgttcgcgagcgacaccgagcacctgaacggcgtgcgcgtggacacc
ggcgtgtacgacggcggcgagatcccgatgtactacgactcgatgatcgccaagctcatc
gtgcacggcaaggatcgccagcacgcgattgcccgcatgcgcgaagcgctcaacggcttc
gtgatccgcggcatcagcagcaacatcccgttccaggcggcgctgcttgcgcatccgaag
ttcgtggcgggcgacttcaacaccggcttcatcgccgagcactacggcaagggcttccat
gcggaagacgtgccgcacgccgatccgtcgttcctcgttgcgctcgcggcctatgtgcac
cgccgctatcgcgcgcgagcctcgggcatcagcggacagctcgaaggccacggtgtgaag
gtaggtgagcagttcgtggtggtggagctcgggcccgagggcaagcatgtgcatcacccg
gtgtcggtgaccgacttccacggcaagaccggcgcgagcgccattgccgtcggcggcaag
aactacaagatcgacagcggttccgcgctcggcgcgatccgcgtgcagggcatggtcaac
gacaagcccttcaccgcgcaggtcgagcgcggcgcgggcaagaaccctctggcgctgcgc
gtgtcgcacgacggcacgcagatcgaggccatggtgctgtcgccgctgggcgcgcgcctg
ctggagctgatgccctacaaggcgccgccggacctgagcaagttcctgatgtcgccgatg
ccgggcctcctggtcgaggtgtcggtggagccggggcagcaggtgcgcgccggcgagaag
ctggctgtcatcgaggcgatgaagatggaaaacgtgctgttcgccacgcaggacggcgtg
gtcggaaaaatctcggcgggcaagggcgaatcgctcgccgtcgaccaaatcattctggag
ttcaattga

DBGET integrated database retrieval system