KEGG   Variovorax paradoxus EPS: Varpa_3846Help
Entry
Varpa_3846        CDS       T01392                                 

Definition
(GenBank) Magnesium chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00860  Porphyrin and chlorophyll metabolism
vpe01100  Metabolic pathways
vpe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Varpa_3846
Enzymes [BR:vpe01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Varpa_3846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 Sigma54_activat MCM AAA AAA_3 AAA_2 Sigma54_activ_2 AAA_30 AAA_22 AAA_16
Motif
Other DBs
NCBI-ProteinID: ADU38027
JGI: Varpa_3846
UniProt: E6V2W1
Position
complement(4138851..4139933)
Genome map
AA seq 360 aa AA seqDB search
MTTAASMPVPFPFSAIAGQPHLRQALLLAAVDPGLGGVLIEGPRGTAKTTAARALAELLP
GAPFVTLPLGASLESLVGTLDLGQALAGHELKFAPGLLARANGGVLYVDEINLLPDALID
SLLDAAASGVNVVERDGISHRHAARFVLVGTMNPEEGTLRPQLLDRFGLCVQLRNIEDAA
ERQGIVRARLAFDVDPQGFRAKHAEAEAALAAALVKARAIVADASALPYGDDVHEAVGAL
CIAAQVDGLRADLVMLRSARALAAWKGAAAITADHVQCVAEAVLLHRRKPEAEGAALASA
SASVPPNTQRAPNSSGTGQNNAGDQDWGAMPPEPVGIERVKPLRPLISSQTAQQALPKKA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgccgcctcgatgccggtgccttttcctttttccgcgatcgcaggtcaaccg
cacctgcgacaggcgctgctgctggccgcggtcgaccccggcctcggcggcgtgctgatc
gaaggcccgcgcggcacggccaagaccacggcggcgcgtgcgctggccgaactgctgccg
ggcgcgcccttcgtcacgctgccgctgggggcgagcctcgaaagcctcgtgggcacgctc
gatctcgggcaggcgctcgcgggccacgaactcaagttcgcgcccggcctgctggcgcgc
gcgaacggtggtgtgctgtatgtggacgaaatcaacctgctgcccgatgcgctgatcgat
tcgctgctcgatgcggcggccagcggcgtcaacgtggtcgagcgcgacggcatctcgcac
cggcatgcggcgcgcttcgtgctggtcggcaccatgaacccggaggagggcacgctgcgc
ccgcaactgctcgaccgcttcgggctgtgcgtgcagttgcgcaacatcgaggacgcggcc
gagcggcaaggcatcgtgcgcgcgcggctcgcgttcgatgtcgatccgcagggctttcgc
gcgaagcatgcggaggcggaagccgcgcttgcggctgcgctcgtcaaggcgcgcgccatc
gtcgcggatgcctccgcgctgccctacggcgacgacgtgcacgaagccgtcggcgcgctg
tgcatcgcggcgcaggtcgacggcctgcgcgccgatctggtgatgctgcgctcggcgcgc
gcgctcgcggcctggaagggcgcggcggccatcaccgccgatcacgtgcagtgcgtggcc
gaagccgtgctgttgcatcgccgcaaaccggaagccgaaggcgcggcattggcatcggcg
tcggcttctgtgcccccaaacacccagcgcgcgccgaactcaagcggcaccggccagaac
aacgcaggcgaccaggactggggcgccatgccgcccgagcccgtcggtatcgaacgcgtc
aagccgctgcgcccgctgatctcttcgcaaaccgcgcagcaggccctcccaaaaaaagcc
tga

DBGET integrated database retrieval system