KEGG   Variovorax paradoxus EPS: Varpa_4027Help
Entry
Varpa_4027        CDS       T01392                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Varpa_4027
   01230 Biosynthesis of amino acids
    Varpa_4027
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Varpa_4027
   00051 Fructose and mannose metabolism
    Varpa_4027
   00562 Inositol phosphate metabolism
    Varpa_4027
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Varpa_4027
Enzymes [BR:vpe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Varpa_4027
Exosome [BR:vpe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Varpa_4027
  Exosomal proteins of bladder cancer cells
   Varpa_4027
  Exosomal proteins of melanoma cells
   Varpa_4027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4343575..4344363)
Genome map
AA seq 262 aa AA seqDB search
MVTTTNNAMTTKKKLIAGNWKMNGGLAVNEALVKALQQGLAASPAACDVALCAPAPYFAQ
LQSLLAGTPSLALGAQDVSAHPQGAFTGEQSAAMLKDFGVRYAIVGHSERRQYHGETDET
VAAKAAAALANGITPIVCVGETLAEREAGQTEEVVKRQLAAVIHVNGHCISEIVVAYEPV
WAIGTGKTASPEQAQAVHAVLRAQLHHAASEHAAGISILYGGSMNAANAAELLAQADIDG
GLIGGASLKAPDFLQIISATAR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggtgacaacgacgaacaacgcgatgacaaccaagaagaaactgatcgccggcaactgg
aagatgaatggcggcctggctgtaaacgaggcgctggtgaaggctctgcagcaagggctg
gccgcaagcccggctgcttgcgatgtcgcgctgtgcgcgccggcgccgtatttcgcccag
ctgcaatcgctgttggcgggcacgccgtcgctggcgctcggtgcgcaggacgtttcggcg
catccgcaaggcgcgtttactggcgagcaatcggcggcaatgctgaaggatttcggggtg
cgctatgccatcgtcggccattccgaacgtcggcagtaccacggcgaaaccgacgagacg
gtggctgcgaaggcggctgccgcattggccaatggcatcacgccgatcgtttgcgtcggc
gagacgctggccgagcgcgaagcagggcagaccgaagaagtcgtcaagcgccagctggca
gcggtgatccatgtgaatggccactgcatcagcgaaatcgttgtggcttacgagccggtc
tgggccatcggcaccggcaagacggcttcgccagagcaagcgcaggcagtgcatgccgtg
ctgcgtgcgcagttgcatcacgcagcgagcgagcacgctgccggcatcagcattctttac
ggcggcagcatgaacgcggccaatgccgccgaactgctggcgcaggccgacatcgatggc
ggcctcatcggtggtgcatcgctcaaggcccccgactttctgcagatcatttctgccact
gcgcgctga

DBGET integrated database retrieval system