KEGG   Variovorax paradoxus EPS: Varpa_4027Help
Entry
Varpa_4027        CDS       T01392                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00010  Glycolysis / Gluconeogenesis
vpe00051  Fructose and mannose metabolism
vpe00562  Inositol phosphate metabolism
vpe00710  Carbon fixation in photosynthetic organisms
vpe01100  Metabolic pathways
vpe01110  Biosynthesis of secondary metabolites
vpe01120  Microbial metabolism in diverse environments
vpe01130  Biosynthesis of antibiotics
vpe01200  Carbon metabolism
vpe01230  Biosynthesis of amino acids
Module
vpe_M00002  Glycolysis, core module involving three-carbon compounds
vpe_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Varpa_4027
   00051 Fructose and mannose metabolism
    Varpa_4027
   00562 Inositol phosphate metabolism
    Varpa_4027
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Varpa_4027
Enzymes [BR:vpe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Varpa_4027
Exosome [BR:vpe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Varpa_4027
  Exosomal proteins of bladder cancer cells
   Varpa_4027
  Exosomal proteins of melanoma cells
   Varpa_4027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADU38199
JGI: Varpa_4027
UniProt: E6V518
Position
complement(4343575..4344363)
Genome map
AA seq 262 aa AA seqDB search
MVTTTNNAMTTKKKLIAGNWKMNGGLAVNEALVKALQQGLAASPAACDVALCAPAPYFAQ
LQSLLAGTPSLALGAQDVSAHPQGAFTGEQSAAMLKDFGVRYAIVGHSERRQYHGETDET
VAAKAAAALANGITPIVCVGETLAEREAGQTEEVVKRQLAAVIHVNGHCISEIVVAYEPV
WAIGTGKTASPEQAQAVHAVLRAQLHHAASEHAAGISILYGGSMNAANAAELLAQADIDG
GLIGGASLKAPDFLQIISATAR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggtgacaacgacgaacaacgcgatgacaaccaagaagaaactgatcgccggcaactgg
aagatgaatggcggcctggctgtaaacgaggcgctggtgaaggctctgcagcaagggctg
gccgcaagcccggctgcttgcgatgtcgcgctgtgcgcgccggcgccgtatttcgcccag
ctgcaatcgctgttggcgggcacgccgtcgctggcgctcggtgcgcaggacgtttcggcg
catccgcaaggcgcgtttactggcgagcaatcggcggcaatgctgaaggatttcggggtg
cgctatgccatcgtcggccattccgaacgtcggcagtaccacggcgaaaccgacgagacg
gtggctgcgaaggcggctgccgcattggccaatggcatcacgccgatcgtttgcgtcggc
gagacgctggccgagcgcgaagcagggcagaccgaagaagtcgtcaagcgccagctggca
gcggtgatccatgtgaatggccactgcatcagcgaaatcgttgtggcttacgagccggtc
tgggccatcggcaccggcaagacggcttcgccagagcaagcgcaggcagtgcatgccgtg
ctgcgtgcgcagttgcatcacgcagcgagcgagcacgctgccggcatcagcattctttac
ggcggcagcatgaacgcggccaatgccgccgaactgctggcgcaggccgacatcgatggc
ggcctcatcggtggtgcatcgctcaaggcccccgactttctgcagatcatttctgccact
gcgcgctga

DBGET integrated database retrieval system