KEGG   Variovorax paradoxus EPS: Varpa_4203Help
Entry
Varpa_4203        CDS       T01392                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00071  Fatty acid degradation
vpe00280  Valine, leucine and isoleucine degradation
vpe00281  Geraniol degradation
vpe00310  Lysine degradation
vpe00360  Phenylalanine metabolism
vpe00362  Benzoate degradation
vpe00380  Tryptophan metabolism
vpe00410  beta-Alanine metabolism
vpe00627  Aminobenzoate degradation
vpe00640  Propanoate metabolism
vpe00650  Butanoate metabolism
vpe00903  Limonene and pinene degradation
vpe00930  Caprolactam degradation
vpe01100  Metabolic pathways
vpe01110  Biosynthesis of secondary metabolites
vpe01120  Microbial metabolism in diverse environments
vpe01130  Biosynthesis of antibiotics
vpe01212  Fatty acid metabolism
Module
vpe_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Varpa_4203
   00650 Butanoate metabolism
    Varpa_4203
  Lipid metabolism
   00071 Fatty acid degradation
    Varpa_4203
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Varpa_4203
   00310 Lysine degradation
    Varpa_4203
   00360 Phenylalanine metabolism
    Varpa_4203
   00380 Tryptophan metabolism
    Varpa_4203
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Varpa_4203
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Varpa_4203
   00281 Geraniol degradation
    Varpa_4203
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Varpa_4203
   00627 Aminobenzoate degradation
    Varpa_4203
   00930 Caprolactam degradation
    Varpa_4203
Enzymes [BR:vpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Varpa_4203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADU38373
JGI: Varpa_4203
UniProt: E6V777
Position
complement(4534281..4535078)
Genome map
AA seq 265 aa AA seqDB search
MDYTRYQTLAITRRGANGTVLDIQMRASNGKLPTAGHDGHRELAEIWRDLSADDTVRCAV
LRGEGLGFSGGGDLSLVQDMATDDAIRQRVWKEARDLVYNIINCDKPIVSAMHGPAVGAG
LVAGLLADISIATKSAKIVDGHTRLGVAAGDHAAIVWPLLCGMAKAKYHLLLCEPVSGEE
AERIGLVSLAVDEADLLPRAYEVADRLAAGSQSAIRFTKYALNNWLRQAGPTFDASLALE
FMGFAGADVREGVASLRERRAPNFG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggactacacccgctaccagaccctcgccatcacccgccgcggcgccaacggcaccgtg
ctcgacatccagatgcgcgcgtccaacggcaagctgccgaccgccggccatgacggccac
cgcgaactcgccgagatctggcgcgacctctcggccgacgacacggtgcgctgcgcggtg
ttgaggggcgaagggctgggattctcgggcggcggcgacctttcgctggtgcaggacatg
gccaccgacgacgccatccgccagcgtgtctggaaagaggcgcgcgacctcgtctacaac
atcatcaactgcgacaagcccatcgtgagcgccatgcacggcccggcggtgggcgcgggg
ctggtggcgggcctcttggccgacatttccatcgccacgaagagcgcgaagatcgtcgac
ggccacacgcgactgggcgtggcggcgggcgaccatgcggccatcgtctggccgctcctg
tgcggcatggccaaggccaagtaccacctgctgttgtgcgagccggtgagcggcgaggag
gccgagcgcatcggcctggtgtcgctcgcggtggacgaggccgacctgctgccgcgcgcc
tacgaagtggccgaccggctcgcggccggaagccagagcgcgatccgcttcaccaagtac
gcgctcaacaactggctgcgccaggccggtccgaccttcgatgcttcgctggcgctcgaa
ttcatgggcttcgcgggtgccgacgtgcgcgaaggcgtggcgtcgctgcgcgagcggcgc
gcgccgaacttcggctga

DBGET integrated database retrieval system