KEGG   Variovorax paradoxus EPS: Varpa_4296Help
Entry
Varpa_4296        CDS       T01392                                 

Definition
type 11 methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
vpe  Variovorax paradoxus EPS
Brite
Enzymes [BR:vpe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Varpa_4296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4620768..4621445
Genome map
AA seq 225 aa AA seqDB search
MNPTPTLERLRFNMIEQQIRPWDVLDLDILDLLATIHREDYVPEAHRTLSFFDMELPLLD
GSVPGEIMLSPKVEARMLHDLKVQKHESVLEIGTGSGFMAALLGARAAQVLSLEINPVLA
ARAAETLRQNGVSNVEVRHADGAVPLPSGPSFDVIVLSGSVARIPQNLLGSLKVGGRLAA
IVGEEPMMRAHFVTRSSESKWDTVQPWDTVAPRLLNFPEPSRFSF
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccacccccaccctcgagcgcttgcgcttcaacatgatcgaacagcagatccgc
ccctgggatgtgctggacctggacatcctcgacctgctggccaccatccaccgggaagac
tacgtgccggaagcccaccgcacgctctccttcttcgacatggagctgcccctcctcgac
ggctccgtgcccggcgagatcatgctgtcccccaaggtcgaggcccgcatgctgcacgac
ctgaaagtgcagaaacatgagtcggtgctcgaaatcggcaccggctcgggcttcatggca
gccctcctcggcgcccgcgccgcccaggtgctgtcgctcgaaatcaatcccgtgctggcc
gcccgcgccgccgagacgctgcgccagaacggcgtgagcaacgtcgaagtgcgccacgcc
gacggcgccgtgcccctgcccagcggcccgagcttcgacgtgatcgtgctgagcggctcg
gtcgcccgcattccgcagaacctgctgggatcgctcaaggtcggcggccgcctcgccgcc
atcgtgggcgaagagccgatgatgcgcgcccacttcgtcacccgctcgagcgaaagcaag
tgggacacggtccagccctgggacaccgtggcgccgcgcctcctgaacttccccgagccc
tcgcgcttctcgttctga

DBGET integrated database retrieval system