KEGG   Variovorax paradoxus EPS: Varpa_4770Help
Entry
Varpa_4770        CDS       T01392                                 

Definition
phosphoglycerate mutase 1 family
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Varpa_4770
   01230 Biosynthesis of amino acids
    Varpa_4770
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Varpa_4770
  Energy metabolism
   00680 Methane metabolism
    Varpa_4770
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Varpa_4770
Enzymes [BR:vpe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Varpa_4770
Exosome [BR:vpe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Varpa_4770
  Exosomal proteins of melanoma cells
   Varpa_4770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5190433..5191176
Genome map
AA seq 247 aa AA seqDB search
MHKLVLIRHGESTWNLENRFTGWTDVDLTETGVEQAKQAGRLLKAEGYDFDVAYTSVLKR
ATRTLWHTLDELDRTWLPVVHSWRLNERHYGGLQGLNKAETAKKYGDEQVLVWRRSYSTP
PPPLEADDPRSERSDVRYAKLSPEQIPLTECLKDTVARVLPFWNESMAPAIRTGRRLVVA
AHGNSIRALVKYLDGISDDAIVGLNIPNGIPLVYELDDDLKPLRHYYLGDAAAAEKAAAA
VASQGKG
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaactggtactgatccgccacggcgaatcgacctggaatctcgaaaaccgcttc
accggttggaccgacgtcgacctgaccgagaccggcgtggaacaggccaagcaggccggc
cggctgctcaaggccgagggctacgacttcgacgtggcctacaccagcgtcttgaagcgc
gccacccgcaccctctggcacacgctggacgaactcgatcgcacctggctgccggtggtg
cactcctggcgcctgaacgagcgccactacggcggcctgcagggcctgaacaaggccgaa
accgccaagaagtacggcgacgagcaggtgctggtctggcgccgcagctacagcaccccg
ccgccgccgctggaagcggacgatccgcgcagcgaacgcagcgacgtgcgctacgccaag
ctctcgcccgagcagattccgctgacggagtgcctgaaggacacggtcgcacgcgtgctg
ccgttctggaacgaatcgatggcgccggccatccgcaccgggcgccgcctggtcgtggcg
gcccacggcaactctatccgggcgctggtgaagtacctggacggcatctcggacgacgcc
atcgtcgggctgaacatcccgaacggcattccgctggtctacgaactggacgacgacttg
aagcccctgcgccactactacctcggcgatgcagccgctgccgaaaaggccgcggccgcg
gtggcttcgcaaggcaagggctga

DBGET integrated database retrieval system