KEGG   Variovorax paradoxus EPS: Varpa_4770Help
Entry
Varpa_4770        CDS       T01392                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00010  Glycolysis / Gluconeogenesis
vpe00260  Glycine, serine and threonine metabolism
vpe00680  Methane metabolism
vpe01100  Metabolic pathways
vpe01110  Biosynthesis of secondary metabolites
vpe01120  Microbial metabolism in diverse environments
vpe01130  Biosynthesis of antibiotics
vpe01200  Carbon metabolism
vpe01230  Biosynthesis of amino acids
Module
vpe_M00002  Glycolysis, core module involving three-carbon compounds
vpe_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Varpa_4770
  Energy metabolism
   00680 Methane metabolism
    Varpa_4770
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Varpa_4770
Enzymes [BR:vpe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Varpa_4770
Membrane trafficking [BR:vpe04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Varpa_4770
Exosome [BR:vpe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Varpa_4770
  Exosomal proteins of melanoma cells
   Varpa_4770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADU38931
JGI: Varpa_4770
UniProt: E6UYM8
Position
5190433..5191176
Genome map
AA seq 247 aa AA seqDB search
MHKLVLIRHGESTWNLENRFTGWTDVDLTETGVEQAKQAGRLLKAEGYDFDVAYTSVLKR
ATRTLWHTLDELDRTWLPVVHSWRLNERHYGGLQGLNKAETAKKYGDEQVLVWRRSYSTP
PPPLEADDPRSERSDVRYAKLSPEQIPLTECLKDTVARVLPFWNESMAPAIRTGRRLVVA
AHGNSIRALVKYLDGISDDAIVGLNIPNGIPLVYELDDDLKPLRHYYLGDAAAAEKAAAA
VASQGKG
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaactggtactgatccgccacggcgaatcgacctggaatctcgaaaaccgcttc
accggttggaccgacgtcgacctgaccgagaccggcgtggaacaggccaagcaggccggc
cggctgctcaaggccgagggctacgacttcgacgtggcctacaccagcgtcttgaagcgc
gccacccgcaccctctggcacacgctggacgaactcgatcgcacctggctgccggtggtg
cactcctggcgcctgaacgagcgccactacggcggcctgcagggcctgaacaaggccgaa
accgccaagaagtacggcgacgagcaggtgctggtctggcgccgcagctacagcaccccg
ccgccgccgctggaagcggacgatccgcgcagcgaacgcagcgacgtgcgctacgccaag
ctctcgcccgagcagattccgctgacggagtgcctgaaggacacggtcgcacgcgtgctg
ccgttctggaacgaatcgatggcgccggccatccgcaccgggcgccgcctggtcgtggcg
gcccacggcaactctatccgggcgctggtgaagtacctggacggcatctcggacgacgcc
atcgtcgggctgaacatcccgaacggcattccgctggtctacgaactggacgacgacttg
aagcccctgcgccactactacctcggcgatgcagccgctgccgaaaaggccgcggccgcg
gtggcttcgcaaggcaagggctga

DBGET integrated database retrieval system