KEGG   Variovorax paradoxus EPS: Varpa_4770Help
Entry
Varpa_4770        CDS       T01392                                 

Definition
(RefSeq) phosphoglycerate mutase 1 family
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Varpa_4770
   01230 Biosynthesis of amino acids
    Varpa_4770
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Varpa_4770
  Energy metabolism
   00680 Methane metabolism
    Varpa_4770
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Varpa_4770
Enzymes [BR:vpe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Varpa_4770
Exosome [BR:vpe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Varpa_4770
  Exosomal proteins of melanoma cells
   Varpa_4770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5190433..5191176
Genome map
AA seq 247 aa AA seqDB search
MHKLVLIRHGESTWNLENRFTGWTDVDLTETGVEQAKQAGRLLKAEGYDFDVAYTSVLKR
ATRTLWHTLDELDRTWLPVVHSWRLNERHYGGLQGLNKAETAKKYGDEQVLVWRRSYSTP
PPPLEADDPRSERSDVRYAKLSPEQIPLTECLKDTVARVLPFWNESMAPAIRTGRRLVVA
AHGNSIRALVKYLDGISDDAIVGLNIPNGIPLVYELDDDLKPLRHYYLGDAAAAEKAAAA
VASQGKG
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaactggtactgatccgccacggcgaatcgacctggaatctcgaaaaccgcttc
accggttggaccgacgtcgacctgaccgagaccggcgtggaacaggccaagcaggccggc
cggctgctcaaggccgagggctacgacttcgacgtggcctacaccagcgtcttgaagcgc
gccacccgcaccctctggcacacgctggacgaactcgatcgcacctggctgccggtggtg
cactcctggcgcctgaacgagcgccactacggcggcctgcagggcctgaacaaggccgaa
accgccaagaagtacggcgacgagcaggtgctggtctggcgccgcagctacagcaccccg
ccgccgccgctggaagcggacgatccgcgcagcgaacgcagcgacgtgcgctacgccaag
ctctcgcccgagcagattccgctgacggagtgcctgaaggacacggtcgcacgcgtgctg
ccgttctggaacgaatcgatggcgccggccatccgcaccgggcgccgcctggtcgtggcg
gcccacggcaactctatccgggcgctggtgaagtacctggacggcatctcggacgacgcc
atcgtcgggctgaacatcccgaacggcattccgctggtctacgaactggacgacgacttg
aagcccctgcgccactactacctcggcgatgcagccgctgccgaaaaggccgcggccgcg
gtggcttcgcaaggcaagggctga

DBGET integrated database retrieval system