KEGG   Variovorax paradoxus EPS: Varpa_4787Help
Entry
Varpa_4787        CDS       T01392                                 

Definition
GTP cyclohydrolase i (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vpe00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5203780..5204511)
Genome map
AA seq 243 aa AA seqDB search
MLRKTDVEPLPDRKDDDEGTPVSVKIRERLNAARKRFNANDNIAEFIQPGELESLLDEVE
VKMKAVLESLVIDVENDHNTDNTARRVAKMYLNEVFRGRYVPPPPLTEFPNAEHLNELMI
VGPITVRSACSHHFCPIIGKLWIGVMPNEHTNVIGLSKYARLAEWVMGRPQIQEEAIVQL
ADLIQEKTRPDGLALVMEAEHFCMAWRGVKEMDSKMINSVMRGVFLKDPSLRREFLSLLP
RKS
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggaaaaccgacgtcgaaccgctccccgatcgaaaagacgatgacgagggcacg
cccgtctccgtcaagatccgcgagcgcctgaatgcagcgcgaaagcgcttcaacgccaac
gacaacatcgccgagttcatccagcctggtgaacttgagtcgctgctcgacgaggtcgag
gtcaagatgaaggccgtgctcgagagcctcgtcatcgacgtcgagaacgaccacaacacc
gacaacaccgcgcgccgcgtggccaagatgtatttgaacgaggtgttccgcggccgctac
gtaccgccgcccccgctcaccgagtttcccaacgccgagcacctgaatgagctgatgatc
gtcggcccgatcacggtgcgcagcgcctgctcgcaccacttctgcccgatcatcggcaag
ctctggatcggcgtgatgcccaacgagcacaccaacgtgatcggcctgtcgaagtacgcg
cgcctggccgagtgggtcatgggccgtcctcagatccaggaagaggcgatcgtgcaattg
gccgacctgatccaggagaagacccggcccgacggcctcgcgctggtgatggaagccgag
cacttctgcatggcctggcgcggcgtgaaggaaatggacagcaagatgatcaattccgtc
atgcgcggcgtgttcctcaaggacccgagcctgcgccgcgaatttctttccctgttgcca
cgaaagagctga

DBGET integrated database retrieval system