KEGG   Variovorax paradoxus EPS: Varpa_4847Help
Entry
Varpa_4847        CDS       T01392                                 

Definition
(RefSeq) pyridoxaL-5'-phosphate-dependent protein beta subunit
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Varpa_4847
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Varpa_4847
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Varpa_4847
Enzymes [BR:vpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Varpa_4847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5264982..5266130)
Genome map
AA seq 382 aa AA seqDB search
MTRQEPARYIDLRTGRYHDLSERRWRSDDGNPMMVTPLPGITRDDIDARERSVWRYRAAL
PVVIDQPASMGEGCTPLVQKRWGAFEPHFKLEWFNPTCSFKDRGASVMISFLRQLGVDAV
LEDSSGNGGAAIAAAGAAAGIKVKVLAPSYTPAPKVAQIRAFGAEVQLVPGPREESEYEA
VRQSESIFYASHNWHPFFLQGTKTLAYELWEDLGFVAPDNVVIPAGAGSNVLGCWIGFKE
LLAAGQIAKLPRIFVAQPLNCSPVDASFVAGVDTLVDRIVKPTIAEGTAIKRPVRLQEIL
QALRETNGKTVALTEEQIAAAVRRLASTGLYAEPTSATAAAAIDVLAERGDIRASETTVV
LLTGTGLKSTQFMTELFGGAAA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacacgccaggaacccgcacgctatatcgatctccgcaccggccggtatcacgacctt
tcggaacgccgctggcgctccgacgacggcaatccgatgatggtgacgccgctgccgggc
atcacgcgcgacgacatcgatgcgcgcgagcgctcggtgtggcgctatcgcgcggcgctg
ccggtcgtgatcgaccagcccgcgagcatgggcgagggctgtacgccgcttgtgcagaag
cgctggggcgcattcgagccgcacttcaagctcgagtggttcaacccgacctgcagcttc
aaggaccgtggtgcgtccgtgatgatttcgttcctgcgccaactgggcgtcgacgcggtg
ctggaagacagctcgggcaacggcggcgcggccatcgccgcggcgggcgcggcggcgggc
atcaaggtgaaggtgctcgcgccgagctacacgccggcgcccaaggtggcgcagatccgc
gctttcggcgccgaggtgcaactggtgccgggaccgcgcgaggagtcggaatacgaggcg
gtgcgccagtcggaatcgatcttctatgcgagccacaactggcatccgttcttcctgcag
ggcacgaagacgctggcctatgaactctgggaagacctgggcttcgtcgcgcccgacaac
gtggtgattccggccggcgcgggcagtaatgtgctcgggtgctggatcggcttcaaggaa
ctgctggccgcggggcagatcgcgaagctgccgcggatcttcgtggcgcagccgttgaac
tgctcgccggtggatgcgagctttgtggcgggcgtggacacgctggttgatcgcatcgtg
aagccgacgatcgccgaaggcacggcgatcaagcggcctgtgcgcctgcaggaaatcctt
caggcgctgcgcgagacgaatggcaagacagtggcgctgaccgaagagcagatcgcggca
gcggtgcgccggttggcttcgacggggctctatgccgagccgacttccgcgacggcggct
gcggccatcgatgtgctggcggagcggggcgacatccgggcgagtgaaaccacggtcgtg
ctgctgacgggcaccggcctgaagtcgacgcagttcatgaccgagctcttcggcggcgct
gccgcctga

DBGET integrated database retrieval system