KEGG   Variovorax paradoxus EPS: Varpa_4961Help
Entry
Varpa_4961        CDS       T01392                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00230  Purine metabolism
vpe01100  Metabolic pathways
Module
vpe_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Varpa_4961
Enzymes [BR:vpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Varpa_4961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 ABC_tran RsgA_GTPase AAA_16 AAA_22 MMR_HSR1 AAA_29
Motif
Other DBs
NCBI-ProteinID: ADU39121
JGI: Varpa_4961
UniProt: E6V242
Position
5386469..5387089
Genome map
AA seq 206 aa AA seqDB search
MDYPGNIFVVAAPSGAGKSSLVKALMELDSAVQPSVSHTTRPPRGQEKHGREYFFASPPE
FDALIAADGFVEWAHVHGHRYGTSKKAIEERIAQGADVILEIDFQGALQIRKTFANAVMI
FILPPSWEELRSRLERRGEDSASVIELRLKNAAEEMARAGEFDFVIINELFERALFDLKA
IVHAQRLRYSAQRRARADTFAALNIP
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggactaccccggcaacatcttcgtggtcgccgcgcccagcggggccggcaaatcgagc
ctggtcaaggcgctcatggagctcgactcggcggttcagccgtcggtgtcacataccacg
cggccgccgcgcggacaggaaaagcacggccgcgagtacttttttgcctcgcctcccgaa
ttcgacgccctgattgcggccgacggcttcgtggaatgggcccatgtgcacggccaccgg
tacggcacctccaagaaggccatcgaggagcggatcgcccaaggggccgacgtgatcctc
gaaatcgacttccagggcgcccttcagatccgcaagacctttgcgaacgcggtgatgatc
ttcatcctgcctcccagttgggaagaacttcgctccaggctcgagcgacgcggcgaggac
agcgcctcggtcatcgaattgcgcctgaaaaacgccgcagaagagatggcccgggccggg
gaattcgacttcgttataatcaacgagttatttgagcgggcgctttttgatctcaaggcg
attgtccacgctcaacggctccggtattccgcacagcgccgtgcacgtgccgacaccttt
gccgcactgaacattccctga

DBGET integrated database retrieval system