KEGG   Variovorax paradoxus EPS: Varpa_4997Help
Entry
Varpa_4997        CDS       T01392                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00900  Terpenoid backbone biosynthesis
vpe01100  Metabolic pathways
vpe01110  Biosynthesis of secondary metabolites
vpe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Varpa_4997
Enzymes [BR:vpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Varpa_4997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADU39157
JGI: Varpa_4997
UniProt: E6V278
Position
5442402..5443283
Genome map
AA seq 293 aa AA seqDB search
MKALYDLPAPAKLNLFLHITGRRDDGYHLLQSVFMLIDWCDTLHVERRRDGQLTREDLTT
ELPADDLILRAARALQTHAAPGQGAHIGVEKHVPAQAGMGGGSSDAATCLLALNRLWNLN
LPLSQLAQIGLKLGADVPFFLGGHHAWVEGIGEEITPVTLPPARFAVVKPTEGLDTRLIF
SADDLERSTPVAIISGFAADSEQLEAKNLGNQVFDFGHNDLQPVAQRLCPAVTDAIEWLG
AQGLKARMTGSGSSVFAKLPQGPHEAELVEAPAGWQVRQCSNLAVHPLVGWAT
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccctctacgaccttcccgcaccggccaagctcaacctgttcctgcacatcacc
ggccggcgcgacgacggctaccacctgttgcagtcggtcttcatgctgatcgactggtgc
gacacgctgcacgtcgagcggcggcgcgacggccagttgacccgcgaagacctcacgacc
gaactgcccgccgacgacctgatcctgcgcgccgcccgggcgctgcagacgcacgccgcg
cccggccagggcgcgcacatcggcgtcgagaagcatgtcccggctcaggcgggaatgggc
ggcgggtcttcggatgccgccacctgcctcctggcgctcaaccgtctctggaacctgaac
ctgcccttgtcacagctcgcacagatcgggctgaaactgggcgccgacgtgcccttcttc
ctcggcggacaccacgcatgggtcgagggaatcggcgaggaaatcacgcccgtcaccctg
ccgccggcacgcttcgccgtggtcaagcccaccgaaggattggatacccgcttaattttt
tctgcggatgaccttgaacgctcaactcctgttgctataatctcgggctttgctgcagat
agcgaacagcttgaagccaagaacctaggcaaccaggttttcgacttcggccacaacgac
ctgcagccggttgcccagcgactttgccccgcggtcaccgatgccatcgaatggctcggc
gcccaaggattgaaggcccggatgaccggctccggaagttcggtgttcgcaaaattgccg
caagggccgcatgaagcggaactggtcgaagcccccgcgggctggcaggttcgtcaatgc
agcaatctggctgttcatcctctggtaggttgggcaacctga

DBGET integrated database retrieval system