KEGG   Variovorax paradoxus EPS: Varpa_5245Help
Entry
Varpa_5245        CDS       T01392                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Varpa_5245
Enzymes [BR:vpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Varpa_5245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5702644..5703606
Genome map
AA seq 320 aa AA seqDB search
MSPKPSSRSPEPPQIVVLGSLNMDLVLRVPHAPAAGETLIGHSIANIPGGKGANQAVSCA
REGAQVRMIGCVGDDAHGRALRESLERDGIDTAALRTVEGEPTGTALILVEDSGQNRIVI
IPGANARVEIDEAAMLGQLQGAAFLVTQFETPMDQIARAISVAHEAGCKVLLNPSPVQAI
AEPLWSRIDTLVVNEIEAETLCGQSADSPQDAARAGRALRAKGIARVVVTLGSRGAVAVD
ADGARHHPAPKVQAVDTTAAGDTFLGALAVALGEGQSFDEAVRLGIRAAALCIQQPGAQP
SIPQRDAVLQSPLPPDWITL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgagtccgaagccttcttcccgcagtcccgagccaccgcaaatcgtggtgctcggcagc
ctcaacatggacctggtgctgcgcgtcccccacgcaccggccgcgggcgaaaccctgatc
ggccattcgatcgccaacatccccggcggcaagggcgccaaccaggccgtgagctgcgcg
cgcgaaggcgctcaggtacgcatgatcggctgcgtgggcgacgatgcccacggccgagcg
ctgcgcgaatcgctggagcgcgacggcatcgacaccgctgcgctgcgcacggtcgagggc
gagcccacgggcacggcgctgatcctggtggaagacagcggccagaaccgcatcgtgatc
attcccggcgccaatgcgcgggtcgaaatcgatgaagcggcgatgcttgggcaactgcag
ggcgcggcctttctggtgacgcagttcgagacgccgatggaccagatcgcacgcgccatt
tcggtggcgcacgaggcgggctgcaaggtgctgctgaatccatcgccggtgcaggcgatt
gccgaaccgctctggtcgcgcatcgacacactggtggtcaacgagatcgaggccgagacg
ctgtgcggccaatcggccgacagcccgcaggacgccgcgcgggcgggccgggcgctgcgc
gccaagggcatcgcgcgcgtggtcgtcacgctcggttcgcgcggcgcggtggcggtcgat
gccgacggcgcgcgccaccatcccgcgccgaaggtgcaggcggtcgacaccaccgccgcg
ggcgacacttttctgggcgcgctcgccgtggcactgggcgaaggccaatccttcgacgaa
gccgtgcgcctgggcatccgcgccgcggcgctctgcatccagcagcccggcgcccaaccg
tccattccgcagcgcgacgccgtgctgcagagtcccctgcctcccgactggatcacgctg
tga

DBGET integrated database retrieval system