KEGG   Variovorax paradoxus EPS: Varpa_5249Help
Entry
Varpa_5249        CDS       T01392                                 

Definition
disulfide bond isomerase, dsbc/g-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
vpe  Variovorax paradoxus EPS
Brite
Enzymes [BR:vpe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Varpa_5249
Secretion system [BR:vpe02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Varpa_5249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5706241..5706963
Genome map
AA seq 240 aa AA seqDB search
MTLARTLLLAACTLGAAMAATAGEAEIRKNLPASIPQFPPIDEVSKSPVNGLYEVRVNGS
QIFYTDEQGSYLIQGNLIDVKTRRNLTEERVEKLSEVAFDKLPLKDSIKIVRGNGKRKLA
VFEDPNCGYCKRFEKDMKTIDNVTVYLFLYPVLGADSTIKSRDIWCSKDKGKAWGDWMEG
GTKPTTAASSCDVTALQRNVEFGRKYNITGTPTLIFSNGTRTPGAIPAEQVEKQLAASAS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcgcacgaaccctcctcctggccgcctgcacgctgggcgcggccatggccgcc
accgccggcgaagccgagatccgcaagaacctgccggccagcatcccgcagttcccgccg
atcgacgaagtctcgaagtcgccggtcaacggcctctacgaagtgcgggtgaacggctcg
cagatcttctacaccgacgagcagggcagctacctgatccagggcaacctgatcgacgtg
aagacgcgccgcaacctcaccgaggagcgcgtcgagaagctcagcgaagtcgcgttcgac
aagctgccgctgaaggactcgatcaagatcgtgcgcggcaacggcaagcgcaagctggcg
gtgttcgaagacccgaactgcggctactgcaagcgcttcgaaaaagacatgaagacgatc
gacaacgtcaccgtctacctgttcctctacccggtgctcggcgccgattcgacgatcaag
tcgcgcgacatctggtgcagcaaggacaagggcaaggcctggggcgactggatggaaggc
ggcaccaagcccaccaccgcggcaagcagctgcgacgtgacggcgctgcagcgcaacgtc
gaattcggccgcaagtacaacatcaccggcacgcccacgctgatcttcagcaacggcacc
cgcacgccgggcgccattcccgcagagcaggtcgagaagcaactcgccgcttccgccagc
tga

DBGET integrated database retrieval system