KEGG   Variovorax paradoxus EPS: Varpa_5460Help
Entry
Varpa_5460        CDS       T01392                                 

Definition
cytochrome p450
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Varpa_5460
  Amino acid metabolism
   00380 Tryptophan metabolism
    Varpa_5460
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Varpa_5460
Enzymes [BR:vpe01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Varpa_5460
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     Varpa_5460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5939377..5942595
Genome map
AA seq 1072 aa AA seqDB search
MAGKNSLYPIPHPAKKPFVGNLLSIGSDSPVLDMWKIAQDLGGIYWLDMPGMPVIVVSSP
ALVDELCEEARFDKSTRGALRRLRAASHGLFTSDTHEETWSKPHNILLANFSQRAMQAYH
PMMLDIAGQLVTKWERLNFDEEVDVVRDMTALTLDTIGLCGFGYRFNSFYREGFHPFVDA
MVRTLETVQNRRGLPLEELMLKKELAQQRKDIRYMHKMVEDIIEERRASGADIATKPDLL
SYMIAGVDKKSGEQLTDKMIRDECIEFLIAGHETTSGLLSFAIYFLLNNPEAMAKAQAEV
DSVFGGDTSQKPTYAQVNRLQYVMQVLKESLRMFPTAPAISMRAKEDTTIGGQYTIKKNN
MVIMHALALHRDKAIWGENADQFNPDNFSREAERERPVNAFKPFGNGQRACIGRQFALQE
AVLTLGMILQRFNLVDHTGYKLKIKEALTIKPENFKIKALLRDPASRPRGNGETTAAPDA
PAKPAARKPQAARHGTSLLVLQGSNLGTAEDLARQLAEAGELRGFSTQVASLDDYAERLP
ANGAVAIVCASYNGVAPDNAAEFHRWLDKADDALNGVRFSVFGCGNTDWAATYQAVPRRI
DERLEALGATRVHPRGEGDAREDMDGAFQDWSDALWPELVKAFGIKAGADTPAEAEPLYT
LEELPPPQKNALVDALGAVALRVVENRELQSPGGDAGTSRSTRHVELMLPEGVNYVPGDH
LSVVPRNSPAQVERAMARFGFDRSAHVRLSAAPGRKTALPVDQVIAVDRLLGDYVELQDV
ATRKQIATLAAYTECPFTKPKLVALSGSDEASQAAYKAEVLHKRKSLLELLEEHRACQVP
FAVFLEMLSPLSPRYYSISSSPSMTPGRCSVTVGVVSEPALSGNGIFEGVCSNYLARAEA
GDTVHGVIRETTAEGFRLPEDAMRPLIMVGPGTGLAPFRGFLQERAAQVERGEALGEAML
FFGCRHPEQDFIYAEELQGWSHRGLMKLHTAFSRSGERKVYVQDLIREQAAAVWKLLEAG
GVIYVCGDGSRMEPDVRRTLTDIAREHGHDSNAWMDKMIADQRYVLDVWAGT
NT seq 3219 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaaaaaactcgctctatccgatcccgcatccggcaaagaaacccttcgtcggc
aacctgctgtcgatcggctccgactctcccgtgctcgacatgtggaagatcgcgcaggac
ctgggcggcatctactggctcgacatgccgggcatgccggtgatcgtggtgtcgtcgccc
gcgctggtcgacgaactctgcgaagaggcccgcttcgacaaaagcacgcgcggcgcattg
cgccggctgcgcgccgcatcgcacggcctcttcacctccgacacgcacgaggagacgtgg
tccaagccccacaacatcctcctggccaacttcagccaacgcgcgatgcaggcctaccac
ccgatgatgctggacatcgcgggccaactggtcaccaagtgggagcggctcaatttcgac
gaagaggtggacgtggtgcgcgacatgaccgcgctcacgctggacaccatcggcctgtgc
ggtttcggctaccgcttcaactcgttctaccgcgagggcttccaccccttcgtcgatgcg
atggtgcgcacgctggagacggtgcagaaccgccgcggcctgccgctcgaggagctgatg
ctcaagaaggagcttgcgcagcagcgcaaggacatccgctacatgcacaagatggtggaa
gacatcatcgaagaacggcgcgcgagcggtgccgacatcgccaccaagcccgacctgctg
agctacatgatcgcgggcgtggacaagaaaagcggcgagcagctcaccgacaagatgatc
cgcgacgagtgcatcgaattcctcatcgcgggccacgagaccacgagcggcctgctctcc
ttcgcgatctacttcctcctgaacaaccccgaggcaatggccaaggcgcaggccgaggtc
gacagcgtgttcggcggcgacacctcgcagaaacccacctatgcgcaggtcaatcggctg
cagtacgtgatgcaggtattgaaggagtcgcttcgcatgttcccgaccgcgcccgcgatc
tcgatgcgcgccaaggaagacacgaccatcggcggccagtacacgatcaagaagaacaac
atggtcatcatgcatgcgctcgcgctgcaccgtgacaaggccatctggggcgagaacgcc
gaccagttcaaccccgacaacttcagccgcgaagccgagcgggagcggccggtgaatgcc
ttcaagcccttcggcaacgggcagcgcgcctgcatcgggcggcagttcgcattgcaggaa
gccgtgctcacgctgggcatgatcctgcagcgcttcaacctggtcgatcacacgggctac
aagctcaagatcaaggaagcgctgacgatcaagccggagaacttcaagatcaaggcgctg
ctgcgcgatccggcctcacgtccgcgcggcaatggcgagacgaccgccgcgccggatgcg
cccgccaagcccgctgcgcgcaagccccaggcggcgcgccacggcacctcgctgctggtg
ctgcagggctccaacctcggcaccgccgaagacctcgcgcggcaactggccgaggccggc
gagctgcgcggcttctccacgcaggtggcttcgctcgacgactacgccgagcgcctgccg
gccaatggcgcggtggccatcgtctgcgcctcgtacaacggcgttgcgcccgacaacgcg
gccgagttccatcgctggctcgacaaggccgacgacgcgctcaacggcgtgcgcttcagc
gtgttcggctgcggcaacaccgactgggccgccacctaccaggcggtgccgcgccgcatc
gacgaacgactcgaagcgctgggcgccacgcgcgtgcatccgcgcggcgaaggcgatgcg
cgcgaagacatggacggcgcgttccaggactggagcgatgcgctctggcccgagctggtg
aaggccttcggcatcaaggccggcgcggacacgccggccgaggccgagccgctctacacg
ctcgaggaactgccgccgccgcagaagaacgcgttggtcgatgcgctgggcgccgtcgcc
ttgcgcgtcgtcgagaaccgcgaactgcaaagccccggtggcgatgccgggacgagccgc
tccacgcgccacgtcgagctgatgctgcccgagggcgtgaactacgtgcccggcgaccac
ctgagcgtggtgccgcgcaacagcccggcacaggtcgaacgtgcgatggcgcgcttcggc
ttcgaccgctcggcgcatgtgcgcctgtcggccgcgccgggccgcaagaccgcgctgccg
gtggaccaggtgatcgcggtcgaccgcctgctgggcgactacgtcgagttgcaggacgtg
gccacgcgcaagcagatcgccacgctcgcggcgtataccgaatgcccgttcaccaagccg
aagctggtcgcgctctcgggcagcgacgaggcctcgcaggccgcgtacaaggccgaggtg
ctgcacaagcgcaagtcgctgctcgaattgctcgaagaacaccgcgcctgccaggtcccg
ttcgcggtgttcctcgaaatgctgtcgccgctgtcgccgcgctactactcgatctcgtcg
tcgccctcgatgacgccgggccgctgcagcgtgaccgtgggcgtggtgagcgagcctgcg
ctctcgggcaacggcatcttcgagggcgtgtgctccaactacctggcgcgcgccgaagcg
ggcgacacggtgcacggcgtgatccgcgagaccacggccgagggcttccggctgccggaa
gacgcgatgcgtccgctgatcatggtcggccccggcacaggcctcgcgccgttccgcggc
ttcctgcaggagcgcgcggcgcaggtcgagcgcggcgaggcgctgggcgaggcgatgctg
ttcttcggctgccgccacccggagcaggacttcatctacgccgaggagctgcagggctgg
tcgcaccgcggcctcatgaagctgcacaccgcgttctcgcgctcgggcgaacgcaaggtg
tatgtgcaggacctgatccgcgagcaggccgcggccgtgtggaaattgctcgaagccggc
ggcgtgatctacgtgtgcggcgacggctcgcgcatggagcccgacgtgcggcgcacgctg
accgacatcgcgcgcgagcacgggcacgacagcaacgcctggatggacaagatgattgcc
gaccagcgctacgtgctggacgtgtgggccggcacctga

DBGET integrated database retrieval system