KEGG   Variovorax paradoxus EPS: Varpa_5467Help
Entry
Varpa_5467        CDS       T01392                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
vpe  Variovorax paradoxus EPS
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Varpa_5467
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Varpa_5467
Enzymes [BR:vpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Varpa_5467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5949642..5950553
Genome map
AA seq 303 aa AA seqDB search
MNTTLELIGAPTDIGASVRGAGMGPDALRVAGVAEALAGQGFTVIDRGNLAGPATPWAPP
ANGLRHLAEVIAWNRSVYNAVDTALGLNHVPLMLGGDHCLAIGSISAVAWHARKRGKKLR
VLWLDAHSDVNTETTSPSGNLHGMPVSCLLGHGPAELTGWSGEPAALAHEAIRFIGIRSV
DSDEKEAIRTLGLNVFDMRHIDEHGMRTTMTEALQDVDDDTHLHVSFDLDCLDPNIAPGV
GTGVRGGPTYREMQLCMEMISDTGRLCSLDVVELNPALDVRNQTAEIAVELIESLFGKST
LVR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccaccctcgaactgatcggcgcaccgaccgacatcggcgccagcgtgcgcggc
gcgggcatggggcccgatgcactgcgcgtggcgggcgtggccgaggcgctcgccgggcag
ggcttcacggtcatcgaccgcggcaatctcgccggcccggccacgccctgggcaccgccg
gccaacggcctgcgccatctcgccgaggtgatcgcgtggaaccgctcggtctacaacgcc
gtcgacaccgcgctgggcctgaaccacgtgccgctgatgctgggcggcgaccactgcctg
gccatcggctcgatcagcgcggtggcctggcatgcacgcaagcgcggcaagaagctgcgg
gtgctgtggctcgatgcgcactccgacgtcaacaccgagacgacgagccccagcggcaac
ctgcacggcatgccggtctcctgcctcttgggccacggccccgcggagctgaccggctgg
agcggcgagcccgcggcgctggcgcacgaggcgatccgcttcatcggcattcgcagcgtc
gactcggacgagaaagaggccatccgcacgctcggcctgaacgtgttcgacatgcgccac
atcgacgagcacggcatgcgcaccaccatgaccgaggcgctgcaggatgtcgacgacgac
acccacctgcatgtgagcttcgacctggattgcctcgaccccaacatcgcgcccggcgtg
ggcaccggcgtgcgcggcggcccgacctaccgcgagatgcagctgtgcatggaaatgatc
tccgacaccgggcggctgtgctcgctcgatgtggtggaactcaaccccgcgctcgatgtg
cgcaaccagacagcggaaatcgccgtggaactgatcgagagcctgttcggcaagtcgacg
ctggtgcggtag

DBGET integrated database retrieval system