KEGG   Variovorax paradoxus EPS: Varpa_5467Help
Entry
Varpa_5467        CDS       T01392                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00220  Arginine biosynthesis
vpe00330  Arginine and proline metabolism
vpe01100  Metabolic pathways
vpe01110  Biosynthesis of secondary metabolites
vpe01130  Biosynthesis of antibiotics
vpe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vpe00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Varpa_5467
   00330 Arginine and proline metabolism
    Varpa_5467
Enzymes [BR:vpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Varpa_5467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADU39622
JGI: Varpa_5467
UniProt: E6V9D8
Position
5949642..5950553
Genome map
AA seq 303 aa AA seqDB search
MNTTLELIGAPTDIGASVRGAGMGPDALRVAGVAEALAGQGFTVIDRGNLAGPATPWAPP
ANGLRHLAEVIAWNRSVYNAVDTALGLNHVPLMLGGDHCLAIGSISAVAWHARKRGKKLR
VLWLDAHSDVNTETTSPSGNLHGMPVSCLLGHGPAELTGWSGEPAALAHEAIRFIGIRSV
DSDEKEAIRTLGLNVFDMRHIDEHGMRTTMTEALQDVDDDTHLHVSFDLDCLDPNIAPGV
GTGVRGGPTYREMQLCMEMISDTGRLCSLDVVELNPALDVRNQTAEIAVELIESLFGKST
LVR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccaccctcgaactgatcggcgcaccgaccgacatcggcgccagcgtgcgcggc
gcgggcatggggcccgatgcactgcgcgtggcgggcgtggccgaggcgctcgccgggcag
ggcttcacggtcatcgaccgcggcaatctcgccggcccggccacgccctgggcaccgccg
gccaacggcctgcgccatctcgccgaggtgatcgcgtggaaccgctcggtctacaacgcc
gtcgacaccgcgctgggcctgaaccacgtgccgctgatgctgggcggcgaccactgcctg
gccatcggctcgatcagcgcggtggcctggcatgcacgcaagcgcggcaagaagctgcgg
gtgctgtggctcgatgcgcactccgacgtcaacaccgagacgacgagccccagcggcaac
ctgcacggcatgccggtctcctgcctcttgggccacggccccgcggagctgaccggctgg
agcggcgagcccgcggcgctggcgcacgaggcgatccgcttcatcggcattcgcagcgtc
gactcggacgagaaagaggccatccgcacgctcggcctgaacgtgttcgacatgcgccac
atcgacgagcacggcatgcgcaccaccatgaccgaggcgctgcaggatgtcgacgacgac
acccacctgcatgtgagcttcgacctggattgcctcgaccccaacatcgcgcccggcgtg
ggcaccggcgtgcgcggcggcccgacctaccgcgagatgcagctgtgcatggaaatgatc
tccgacaccgggcggctgtgctcgctcgatgtggtggaactcaaccccgcgctcgatgtg
cgcaaccagacagcggaaatcgccgtggaactgatcgagagcctgttcggcaagtcgacg
ctggtgcggtag

DBGET integrated database retrieval system