KEGG   Variovorax paradoxus EPS: Varpa_5992Help
Entry
Varpa_5992        CDS       T01392                                 

Definition
guanine-specific ribonuclease n1 and t1
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
vpe  Variovorax paradoxus EPS
Brite
Enzymes [BR:vpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     Varpa_5992
Messenger RNA biogenesis [BR:vpe03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     Varpa_5992
Transfer RNA biogenesis [BR:vpe03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    Varpa_5992
 Prokaryotic Type
    Varpa_5992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6518645..6519058
Genome map
AA seq 137 aa AA seqDB search
MAAYASITSSTSKFALTSLMLLALTTGAEARGWFGAGKTSAEESIALTDLPVQGQRTYQA
ILNGGPFRYEKDGTVFGNRERLLPSARRGHYREYTVTTPGSRNRGAQRIVCGGEQRTTPE
ACWYTADHYASFRRIAP
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttacgcctcgatcacgtcctctacctcaaagtttgcgctcaccagcctgatg
ctgttggcgttgacgaccggggccgaggcccgcggatggttcggcgcaggaaaaacgtcc
gctgaggaatcgattgcactgaccgatctcccggtccagggccagcgaacctatcaggcc
atcttgaacggtggccccttccggtacgaaaaggacggcactgtatttggcaaccgcgag
cgtctcctgccgtcggcacggcgcggccactaccgcgagtacacggtgacgacaccgggt
tctcgcaaccggggtgcccagcgaatcgtctgcggtggcgagcagcgcacgacgcccgag
gcctgctggtacacggcagaccactatgcaagtttcagacggattgcgccatga

DBGET integrated database retrieval system